KEGG   Actinobacillus succinogenes: Asuc_0198Help
Entry
Asuc_0198         CDS       T00558                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
asu  Actinobacillus succinogenes
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Asuc_0198
Enzymes [BR:asu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Asuc_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
234004..234936
Genome map
AA seq 310 aa AA seqDB search
MKKLTVLGSINADHVISVPYFAKPGETLTGSHYHIAYGGKGANQAVAAARLCDQSQMTVS
FIGCIGEDGIGRTMKQAFADDGINVAPIVEVKDETTGIAMIQVAATGENSIVISPGANAY
LNEEVVERFSDEITSADYLLMQLETPLPAIMKAAALAKKHGTKVVLNPAPARPLPDELLT
NTDIITPNETEAEILTGVCVTDEQSAVKSAQVFHDKGIETVLITLGSKGVYFSRQSKGGI
VAGFRVRAVDTTAAGDTFNGAFLTALLDGKTMANAITFAHAAAALSVTREGAQPSIPSRA
ETLRFLAQQG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgacggttttaggcagtattaatgcggatcatgtaatttccgtaccttat
tttgccaaacccggggaaaccctgaccggttcccattatcacatagcttacggcggtaaa
ggggcgaatcaggcggtagcggcggcgcgtttgtgtgatcaatcgcaaatgacggtgagt
tttatcggctgtatcggcgaagacggtatcggccgcaccatgaaacaggcatttgccgat
gacggaattaatgtggcgccgattgtggaagtgaaagacgaaactaccggcatcgctatg
attcaggtcgccgcaacgggcgaaaacagtatcgtaatttcgccgggcgccaatgcatat
ctgaacgaagaggtggtggagcgtttttcagacgaaatcacttcggcggattatctgctt
atgcaattggaaacgccgttaccggcgattatgaaagccgccgcactggcgaaaaaacac
ggtaccaaagtggtgttaaatccggcgcccgctcgcccattaccggacgaattgctgacg
aacaccgacattattacgccgaacgaaacggaagcggaaatcttaaccggcgtttgcgtc
accgacgaacaaagtgcggtcaaatccgcgcaggtttttcacgacaagggcattgaaacc
gtactgatcacgctcggctcgaaaggcgtttatttcagccgtcaaagcaaaggcggtatc
gtcgccggttttcgcgttcgggccgtggatactaccgccgccggtgacaccttcaacggt
gcgtttttaaccgcgctgttagacggtaaaaccatggcgaacgccattactttcgcgcat
gcggcggcggcgctcagcgtcacccgcgaaggcgcgcaaccgtccattccgagtcgcgcc
gaaactttacgttttttagcacaacaggggtga

DBGET integrated database retrieval system