KEGG   Actinobacillus succinogenes: Asuc_0211Help
Entry
Asuc_0211         CDS       T00558                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
asu  Actinobacillus succinogenes
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Asuc_0211
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Asuc_0211
Enzymes [BR:asu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Asuc_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
246939..247979
Genome map
AA seq 346 aa AA seqDB search
MSTLLIDLKGQTLRQEEVELLEHPLVAGLILFTRNFYDRPQIQALVKDIRQRVKKPLLIT
VDQEGGRVQRFRDGFTKLPAMQSFAALIQEPEQQLATAKEAGWQMAAEMTALDIDLSFAP
VLDLGHECKAIGDRSFCSDAESVFRLASAFIDGMHAAGMATTGKHFPGHGHVLADSHLET
PFDNRPSAVIFERDIRPFQRLIAQNKLNAVMPAHVIYTDCDDQPASGSKYWLQDILRRKL
GFHGAVFSDDLGMKGAGFMGDFVTRSEKALSAGCDLLLLCNEPDGVVQVLDNLKLNESRP
HFEARQQRLKTLFKKKSFNWTELTQTEKWLKNTQKLTALQAQWQSS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtccacattactcatcgatctgaaaggtcaaaccctgcgacaggaagaagtcgagttg
ctcgaacacccgctggttgccgggcttattctgtttacccgaaatttttatgatcgccca
caaattcaggcgttagtgaaagatatccgtcaacgggtcaaaaaaccgttactcattacg
gtggatcaggaaggcgggcgggtacagcgttttcgcgacggtttcaccaaactgcccgcc
atgcaatctttcgccgcgttgattcaagaacccgaacaacaacttgcgacagcaaaagaa
gccggctggcaaatggcggcggaaatgacggcgttagacatcgatctcagcttcgccccg
gtgttggatttggggcacgaatgcaaagccatcggcgatcgcagtttctgcagtgatgcg
gagtccgtcttccgtctggcctccgcctttatcgacggtatgcatgccgcgggtatggca
accaccggcaaacatttccccggacacggacacgtattagcggacagccatttggaaacg
ccgttcgacaaccgtccaagtgcggttattttcgaacgggatattcgaccgttccaacgg
cttatcgctcaaaacaaattaaatgccgtaatgccggcgcatgtcatctacaccgattgc
gacgaccaacccgccagcggttcaaaatactggttacaggatattttacgccgaaaattg
ggcttccacggtgccgttttctccgatgatctcggtatgaaaggcgccggctttatggga
gatttcgtcactcgcagcgaaaaagccctcagcgccggttgcgatttattgttgctctgc
aacgaaccggacggcgtcgtacaagtgctggacaatttaaaacttaacgaatcccggccg
cactttgaagcccgtcagcaacggttaaagaccctgtttaagaaaaaatctttcaactgg
accgaattgacgcaaaccgaaaaatggctgaaaaatacgcagaaattgaccgcacttcag
gcgcaatggcaatcaagttga

DBGET integrated database retrieval system