KEGG   Actinobacillus succinogenes: Asuc_0277Help
Entry
Asuc_0277         CDS       T00558                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Asuc_0277
Enzymes [BR:asu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Asuc_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(311359..312303)
Genome map
AA seq 314 aa AA seqDB search
MYREPHFGKFALSRLLPFAEQFPVQYIDGQNHCRVAYRHFHHQTHRKLVILVNGRAENLL
KWTEVAYDFYHRGYDVLAFDHRGQGFSQRLLRDKQKGYLDEFRFYAADMAKIIEKNTALF
SYQTQHILAHSMGGLISAYYLADYDHHISNAVFCAPFFGMPLKRPIRDQAIIGLMLLFGQ
GERYVFGKKPYRPVNVSVNDLSSCATRMKWMNRVNRKHPELGLGGPTFRWVHLCLQAIRR
LPQILPKIDIPVLILQSEREKIVANKNLENLTALLRQGKLERIPLAKHEILFEKDDVREN
ALQKIWTFMDNPLN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgagaacctcatttcggcaaattcgcactgagccgactgcttccctttgcggaa
cagtttcccgttcaatatattgacggacaaaaccactgtcgtgtagcgtatcgtcatttt
catcatcagacgcatcgtaaactggtgattttggtaaacggacgggcggaaaatttactg
aaatggacggaagtcgcttatgatttttatcaccgcggttacgacgtgctggcgttcgat
caccgcgggcaaggattttcacaacgtttgttgcgggataaacagaaaggttatctggac
gaatttcgcttttatgcggcggatatggcaaaaattattgaaaaaaataccgcacttttt
tcttatcaaacccaacatattctggcccattccatggggggcttgatttccgcctattat
ttagcggattatgaccatcatatcagcaatgctgtattctgcgcaccgtttttcggcatg
ccgttaaagcgcccgattcgggatcaagcgatcatcggcctgatgctgttgttcggacaa
ggagagcgttacgtattcggtaagaaaccgtatagaccggtaaatgtttctgtaaatgat
ttaagcagttgtgcgacgcggatgaaatggatgaaccgggtaaatcgtaaacatcccgaa
ttgggactgggcgggccgacttttcgttgggtacatttatgcctgcaagcaatccggcgt
ttaccgcagattttgccgaaaatcgacattcccgtgctgattttacaatcggagcgggaa
aagatcgtagcgaataaaaatctcgaaaatctgaccgcacttttgcggcaaggcaaattg
gagcgaatcccgctggcgaagcatgaaattctgtttgaaaaagatgatgtgcgggaaaac
gctttacagaaaatctggacatttatggataatccgttaaattga

DBGET integrated database retrieval system