KEGG   Actinobacillus succinogenes: Asuc_0355Help
Entry
Asuc_0355         CDS       T00558                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
asu  Actinobacillus succinogenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Asuc_0355
Enzymes [BR:asu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Asuc_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(403161..403910)
Genome map
AA seq 249 aa AA seqDB search
MAVLVTRPDSRGEQLTEALNKAGVAALHMPLFSISAGRELNELPNKMYQLKAGDYVFAVS
KNAVEFAAETLSNTGFRWRQDLIYFAVGQSSAEYFCEQSEQPVHYPYGHENSEGLLALPQ
MQRLTDKTVLILRGNGGRELFPAQAVRRGAQVEIIECYRRVPVEYDPKKQTDLCQRAGIN
TIIATSSEILTRLTNFVPAEERDWLTQCRLVTASYRVAKSAERAGWQKRQILIAPRADNA
TLVKMLAEK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcggttttggtcacacgtcccgacagtcgcggcgaacagttaacggaagcgctgaat
aaagcgggcgtggctgcattacacatgccgcttttcagtatttctgccgggcgcgaactc
aatgaattaccgaataaaatgtaccaactgaaagccggtgattacgtgtttgccgtatct
aaaaatgcggtggaatttgccgccgaaaccctgagtaatacgggatttcgctggcgtcag
gatttaatttattttgctgtcgggcaaagttcggcggaatatttttgcgaacaaagcgag
cagccggtgcattatccttacggacatgaaaacagcgaaggattgctggcattgccgcaa
atgcaacggttaacggacaaaaccgtgttgattttgcgcggaaacggcggacgggaacta
tttcccgcacaagccgtccggcgtggcgcgcaggtggagattatcgaatgttatcggcgt
gtaccggtagaatacgatcccaagaaacaaacggatttatgccagcgcgccggaattaac
acgattatcgccaccagcagtgaaattttaacccgtttaacgaatttcgtgccggcagaa
gaacgggattggttaacgcagtgtcgattggtgacggcgagttaccgagtggcaaaatca
gccgaacgcgccggttggcaaaaacggcaaattttgattgcgccaagagcagataatgcc
acattggtgaaaatgttagcggaaaaataa

DBGET integrated database retrieval system