KEGG   Actinobacillus succinogenes: Asuc_0572Help
Entry
Asuc_0572         CDS       T00558                                 

Definition
(GenBank) phosphoglycerate mutase 1 family (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asuc_0572
   01230 Biosynthesis of amino acids
    Asuc_0572
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0572
  Energy metabolism
   00680 Methane metabolism
    Asuc_0572
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asuc_0572
Enzymes [BR:asu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Asuc_0572
Exosome [BR:asu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Asuc_0572
  Exosomal proteins of melanoma cells
   Asuc_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
633618..634301
Genome map
AA seq 227 aa AA seqDB search
MQLVFIRHGLSEWNALNLFTGWRDVNLSEKGVEEAKEAGRKLKAAGFEFDIAFTSVLTRA
IKTCNLVLEESDQLWVPQIKTWRLNERHYGGLQGLNKAEAAAEHGDEQVRIWRRSYDVLP
PVLDPKDPNSAHNDRRYAHLPADVVPDCENLKVTLDRVLPFWEDQIAPAIKAGKRVLVAA
HGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYELDDNLKVLSKRYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagtatttattcgtcacggtttaagcgaatggaatgcgttaaaccttttcacc
ggctggagagacgtaaacctgagcgaaaaaggcgtggaagaagccaaagaggcggggcgt
aaattaaaagccgccggtttcgaattcgacatcgcatttacttccgtattaacccgtgcg
attaaaacctgtaacttagtgttggaagaatccgaccaattatgggtgccgcaaatcaaa
acctggcgtttaaacgagcgtcactacggcggtctgcaaggtttgaataaagcggaagcg
gcggccgaacacggcgacgaacaagtccgtatctggcgtcgttcatatgatgtgttaccg
ccggttttggatccgaaagatccgaattcagcgcataacgaccgtcgttacgcacattta
ccggcggatgtggttccggattgcgaaaacttaaaagtgacgctggatcgcgtattaccg
ttctgggaagaccaaattgcaccggcaattaaagcgggtaaacgcgtgctagtggcggcg
cacggtaactcgttgcgtgcattggcaaaacatatcgaaggtatttccgacgaagacatt
atgggtttggaaattccgaccggtcaaccgttagtatatgaattagacgataacctgaaa
gtgctcagtaaacgttatctttaa

DBGET integrated database retrieval system