KEGG   Actinobacillus succinogenes: Asuc_0572Help
Entry
Asuc_0572         CDS       T00558                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00010  Glycolysis / Gluconeogenesis
asu00260  Glycine, serine and threonine metabolism
asu00680  Methane metabolism
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01130  Biosynthesis of antibiotics
asu01200  Carbon metabolism
asu01230  Biosynthesis of amino acids
Module
asu_M00002  Glycolysis, core module involving three-carbon compounds
asu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0572
  Energy metabolism
   00680 Methane metabolism
    Asuc_0572
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asuc_0572
Enzymes [BR:asu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Asuc_0572
Membrane trafficking [BR:asu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Asuc_0572
Exosome [BR:asu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Asuc_0572
  Exosomal proteins of melanoma cells
   Asuc_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABR73947
UniProt: A6VLV0
Position
633618..634301
Genome map
AA seq 227 aa AA seqDB search
MQLVFIRHGLSEWNALNLFTGWRDVNLSEKGVEEAKEAGRKLKAAGFEFDIAFTSVLTRA
IKTCNLVLEESDQLWVPQIKTWRLNERHYGGLQGLNKAEAAAEHGDEQVRIWRRSYDVLP
PVLDPKDPNSAHNDRRYAHLPADVVPDCENLKVTLDRVLPFWEDQIAPAIKAGKRVLVAA
HGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYELDDNLKVLSKRYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagtatttattcgtcacggtttaagcgaatggaatgcgttaaaccttttcacc
ggctggagagacgtaaacctgagcgaaaaaggcgtggaagaagccaaagaggcggggcgt
aaattaaaagccgccggtttcgaattcgacatcgcatttacttccgtattaacccgtgcg
attaaaacctgtaacttagtgttggaagaatccgaccaattatgggtgccgcaaatcaaa
acctggcgtttaaacgagcgtcactacggcggtctgcaaggtttgaataaagcggaagcg
gcggccgaacacggcgacgaacaagtccgtatctggcgtcgttcatatgatgtgttaccg
ccggttttggatccgaaagatccgaattcagcgcataacgaccgtcgttacgcacattta
ccggcggatgtggttccggattgcgaaaacttaaaagtgacgctggatcgcgtattaccg
ttctgggaagaccaaattgcaccggcaattaaagcgggtaaacgcgtgctagtggcggcg
cacggtaactcgttgcgtgcattggcaaaacatatcgaaggtatttccgacgaagacatt
atgggtttggaaattccgaccggtcaaccgttagtatatgaattagacgataacctgaaa
gtgctcagtaaacgttatctttaa

DBGET integrated database retrieval system