KEGG   Actinobacillus succinogenes: Asuc_0631Help
Entry
Asuc_0631         CDS       T00558                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00340  Histidine metabolism
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01230  Biosynthesis of amino acids
Module
asu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Asuc_0631
Enzymes [BR:asu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Asuc_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Muted KxDL
Motif
Other DBs
NCBI-ProteinID: ABR74005
UniProt: A6VM08
Position
692450..693730
Genome map
AA seq 426 aa AA seqDB search
MQTLIWNNLTETEKQQYLARPAQVIGDSIKKAVDEIKANVLANGDSALFELSEKFDKVKL
DGLIVSQAQISEAEKRISPELKQAIQNAKANIETFHKAQRNQEVDIETQAGVRCQVVTRP
INRVGLYIPGGSAPLFSTVLMLAVPAKIAGCKKIVLCSPPPIADEILYTANLCGVETIYA
VGGAQAVIAMANGTETVAKVDKIFGPGNAFVTEAKRQVVQEGTAIDMPAGPSEVLVIADE
FADPAFVASDLLSQAEHGADSQVILVTPSEKLAKAVDDELEKQVELLPRAETARKALAHS
RTFIAESLRQAVEISNEYAPEHLIVQTENARALLADLDNAGSIFLGAYSPESMGDYASGT
NHVLPTYGYTKTYSSLGLADFSKRMTVQELTPQGFKDLAETVELMAAAERLDAHKQAVSI
RLAKIQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccctgatttggaacaatttaacagaaaccgaaaaacagcaatatctcgcccgt
ccggcacaggttatcggcgacagtatcaaaaaagccgtagacgaaatcaaagccaacgta
ttggcgaacggcgatagcgctttattcgagctgagcgaaaaattcgacaaggtgaaatta
gacggattgatcgtctcgcaagcgcagattagcgaggcggaaaaacgtatttcgcccgaa
ctgaaacaagcgattcaaaatgcgaaagcgaatatcgaaacttttcataaagcccaacgg
aatcaagaagtggatatcgaaactcaggcgggtgtgcgttgccaagtagtgacccgcccg
attaaccgcgtggggctttatatcccgggcggttccgctccgctgttttccaccgtatta
atgcttgccgttcccgccaaaatcgccggctgtaaaaaaatcgtactgtgctcgccgccg
ccgattgccgatgaaatcctttataccgccaatctttgcggggtggaaaccatttatgcg
gtgggcggggcgcaggcggtgatcgcaatggcgaacggcaccgaaaccgtcgccaaagtg
gataaaatcttcggcccgggtaatgcttttgtcaccgaagccaaacgccaagtcgtgcag
gaaggcacggcaatcgatatgccggcaggtccaagcgaagtattagtgattgccgacgag
tttgccgacccggcttttgtggcgagcgatttgctttcccaggcggagcacggggcggat
tcgcaagtgattttagtcaccccgagcgaaaaactggctaaagcggtggacgacgagctg
gaaaaacaggttgagctgctgcctcgagccgaaaccgcccgtaaagcccttgcccacagc
cgcacgtttattgccgagagcttgcggcaagcggtggaaatcagcaacgaatacgcgccg
gaacatttaatcgtgcaaaccgaaaacgcccgcgcactattagcggatttagataatgcc
gggtcgattttcttaggcgcttactcgccggaatccatgggcgattacgccagcggcacc
aaccacgtgctgccgacttacggctacaccaaaacctactccagcctcggtttggcggat
ttcagcaaacgcatgaccgtacaggaactcaccccgcaaggcttcaaagatttagccgaa
accgtcgaactgatggcggcggcggaacggttggacgcccataaacaggcggtgagtatt
cggttggcgaagattcaatga

DBGET integrated database retrieval system