KEGG   Actinobacillus succinogenes: Asuc_0657Help
Entry
Asuc_0657         CDS       T00558                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00900  Terpenoid backbone biosynthesis
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Asuc_0657
Enzymes [BR:asu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Asuc_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABR74030
UniProt: A6VM33
Position
716912..718099
Genome map
AA seq 395 aa AA seqDB search
MKKQNLVILGSTGSIGTSTLSVIEHNSEKYRAFALVGGHNADLMAEQCVKFQPEFAALDD
ESAAKKLHEKLTALGCKTQVLSGQKAICELAAHPEADQIMAAIVGAAGLLPTLSAVQAGK
RVLLANKESLVTCGQIFIDAVKKYGAQLLPVDSEHNAIFQSLPPQAQQKIGFCPLSELGV
SKIVLTGSGGPFRYTDLSEFDGITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWL
FNAGADDMEVIIHPQSIIHSMVRYVDGSVIAQMGNPDMRTPIAETMAYPNRIVSAVAPLD
FYQLNGLTFLQPDFSRYPNLKLAIDAFAAGQYATTAMNAANEVTVEAFLNRQIKFTDIAK
VNATVVEKIQPQIISCVDDVLDVDRQARELAESFL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaaatttagtgatcttgggttccaccggttccatcggtaccagtacgctt
tccgttattgaacataattctgaaaaatatcgggcatttgccttggtcggcgggcataac
gcggatttaatggctgaacagtgcgtaaaatttcagcccgaatttgccgcattagacgat
gaaagtgcggctaaaaaattacatgaaaaattgaccgcacttggctgtaaaactcaggtg
ttaagcgggcaaaaagcaatttgcgaattggcagcgcatcctgaagcggatcaaattatg
gcggcaatcgttggggccgccggtttattgccgacattgtctgccgtgcaggcaggaaaa
cgcgtgctgttggcgaataaagaaagtttagtgacgtgcggacagatttttatcgatgcc
gtaaaaaaatacggtgcgcaattgttaccggtggatagcgaacataatgcgatcttccaa
tctttaccgccgcaagcgcaacagaaaatcggattttgtccgttgtctgaattaggcgtg
agcaaaattgtgctgaccggttcgggcggaccgtttcgttatacggatttaagcgaattt
gacggcattacaccggaacaggcggtagcgcacccgaattggtccatgggcaagaaaatc
tcggtagacagcgctaccatgatgaataaagggctggaatatatcgaagcgcgttggttg
tttaatgccggtgcggatgatatggaagtgattatccatccgcaatccattattcattct
atggtgcgttatgtggacggttcggtcatcgcacaaatggggaatccggatatgcgtaca
ccgattgccgaaactatggcgtatccgaaccggattgtttccgctgtggcgccgctggat
ttttatcagttaaacggcttaacttttttacagccggatttcagccgttatccgaatttg
aaactggcgatagatgcttttgccgccgggcagtatgccactacggcaatgaatgcggcg
aacgaagttacggtcgaggctttcttaaaccgtcaaattaagtttacggatatcgccaaa
gtgaatgcaacggtagtagaaaaaattcaaccgcagattatttcttgcgtagacgatgtg
ctggatgtggatcgtcaagcgagagaattagccgaatcttttctgtaa

DBGET integrated database retrieval system