KEGG   Actinobacillus succinogenes: Asuc_0667Help
Entry
Asuc_0667         CDS       T00558                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
asu  Actinobacillus succinogenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:asu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
725344..726366
Genome map
AA seq 340 aa AA seqDB search
MAQQYFTGYPSRRLRRMRKNDFSRRLMAENKLTADDLIYPVFIMEGENQREPVPSMPKVE
RLTIDQLLTEAGLLVKYGVPVIALFPVVGQEKKSLMAEEAYNPNGLVQRAVRALKAAYPE
LGVLTDVALDPYTLHGQDGIIDETGYVLNEVTSEVLVKQALSHAEAGADIVAPSDMMDGR
IGKIRVMLEEKGYINTLIMAYAAKYASNYYGPFRDAVGSSGNLKGGDKKTYQLDPANGNE
GLQEVALDIAEGADMVMVKPGMPYLDMVYRVKEEFGVPTFAYQVSGEYAMHCAAIQNGWL
KEKECIMEGLLCFKRAGADGILTYFAKQVARWLYEEGKNN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacaatattttacgggttatccaagccgtcgtttacgccgtatgcgtaaaaac
gatttcagccgtcgtttaatggcggaaaataaactgaccgcagatgatttaatttatccg
gtctttattatggaaggcgaaaatcagcgcgagccggtaccttctatgccgaaggtggaa
cgcttgaccatcgatcagttattaacggaagccggcttactggtaaaatacggcgtaccg
gttatcgcgttatttccggtagtcggtcaggagaaaaaatccttgatggcggaggaagcc
tataatccgaacggtttggtacaaagagcggtacgcgcattgaaggcggcatatcccgaa
cttggcgtattaacggatgtggcgttggacccttataccctgcacggacaagacggtatt
atcgacgaaaccggttatgtgctgaatgaagtgaccagcgaagtgctggtaaaacaagcg
ttatcccatgcagaagccggtgcggacattgtggcgccgagcgatatgatggacgggcga
atcggtaaaatccgcgtaatgttagaagaaaaggggtacatcaacacactgattatggcc
tatgccgcaaaatacgcctcgaattattacggaccgttccgcgatgccgtcggttcttcc
ggtaatctgaagggcggtgataagaaaacctatcaactggatcccgctaacggtaacgaa
ggtctgcaggaagtggcgttagatattgcggaaggggcggatatggtcatggttaaaccg
ggaatgccgtatctggatatggtctatcgcgttaaagaagaattcggcgtgccgactttc
gcttatcaggtttccggtgaatacgctatgcattgcgccgctattcaaaacggttggttg
aaagaaaaagaatgtattatggaaggcttgctctgttttaaacgagccggtgcggacggt
attttgacttattttgccaaacaggttgcccggtggctgtatgaagaaggcaagaataac
taa

DBGET integrated database retrieval system