KEGG   Actinobacillus succinogenes: Asuc_0674Help
Entry
Asuc_0674         CDS       T00558                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
asu  Actinobacillus succinogenes
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
733148..735787
Genome map
AA seq 879 aa AA seqDB search
MKLQFETLDYQLNAVNAAVNLFIGQPNATSGFALRSQNDLRFIPNLPLQISDEQLQQNLA
NQQNYQKIDRTLLSENGKNFTVEMETGTGKTYVYLRTIFELNKQYGWQKFVIVVPSVAIR
EGVLHTLDITQTHFNHVFDKPSVSPKFEYKSNQLSRLKTFANSNHIEILVMNIDAFAKDS
NVINTINESGEAPISYIQKANPIVIIDEPQNMETDIRRNAIESLNPLFTLRYSATHKNAY
NPIFSLNPVQAYELGLVKQIEVDSVVAENEVNGVYLALKEIKTAAKSWSAKIELLFNDSK
AMKKKVVTVKPNQDLYDFSNQNEMYRSGFILSGMDAESQMVEFSNGTQIFQGVDHSQLKD
DLQKMQIRRTVAEHLQKEKKLRPLGVKVLSLFFIDKVDNYRSSAEKPSGGKFAQWFEEIY
RELAKEEPSGVHNGYFSQDKKGVAKDTNGTTQVDNDTYQLIMRDKEKLLSLDNPLRFIFS
HSALREGWDNPNVFQICTLNDTASEMKKRQEIGRGLRLPVNQHGQRIYDRAQSTLTVIAN
ESYEQFAATLQREIEEDCGVKFAKSHIKKREDKREVRYRKDFSLHPDFVAIWERIKQQTT
YRVNFSNDELIERAVEKIHKMPAIEATKIKHAKAKLVIDESGIATDYRAAGETTVHSQWA
IPALLNELQKKTGLTRITLCKILQQSDRLQEVFRNPQRFIDLVAEKINAVLQLIMADGIE
YRKIAGKSYEMTLFRDFEFYANPYTFAVNDKTKTIYEDCISLDSTTEYTFAKHCESSEDI
EFYFKLPERFKIPTPLGNYNPDWAVVFKGENKIYFVAETKNTGKGIQSGVDEDKLRENEQ
LKIAYARKNFHYLRLDYPDLDYQVVENVEELSGQYRNLR
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccaatttgaaaccttagattaccaacttaatgccgtaaatgcggcggtgaat
ttgtttatcgggcagccgaatgcgactagtggatttgcgttaagatcgcaaaatgatttg
cgttttatcccgaatttaccgttgcaaatcagcgatgaacaattacagcaaaatttagct
aatcagcaaaattatcaaaaaatcgaccgcactttgcttagcgaaaacggtaaaaatttt
accgtggagatggaaacgggaacgggcaaaacctatgtttatttacgcaccatttttgag
ctgaacaaacaatacggttggcaaaaatttgtgattgtggtgccgagcgttgccattcgt
gagggggtattgcatacccttgacatcacgcaaacgcattttaaccatgtgtttgataag
ccaagcgttagcccgaagtttgaatataaaagcaatcagctttcccgtttaaaaaccttt
gcgaacagtaatcatattgagattttggtgatgaatattgatgcttttgccaaagacagc
aatgtgattaataccatcaacgaaagtggcgaagcacccatcagctatattcaaaaagcc
aatccgattgtcatcattgatgaaccgcaaaatatggaaacggacattcgccgcaatgcg
attgagagcttaaatccgctgtttaccttgcgttattcggcaacccataaaaatgcctat
aacccgattttcagcttaaaccctgtgcaagcttatgagctaggcttggtgaaacagatc
gaagtggacagtgtagtggcagaaaatgaggtaaatggcgtttatcttgcgttaaaagag
atcaaaactgcggcaaaaagttggtcggcaaaaattgagttattgtttaacgatagcaaa
gcaatgaagaaaaaagtcgtgactgtgaaacctaatcaggatttgtacgatttttccaat
caaaacgaaatgtatcgttccggttttattttgagcggaatggatgcggaaagccaaatg
gtagaattttctaacggcacacagatttttcaaggcgttgatcattctcagctaaaagac
gatttgcaaaaaatgcaaattcgccgaaccgttgccgaacatttgcaaaaagagaagaaa
ttacggccgcttggagtgaaagttttatcgctattttttattgataaagtagataactac
cgctcatctgcagaaaaaccttcagggggcaaatttgcacaatggtttgaagaaatttat
cgtgaattagcgaaagaagaaccgagcggcgtacacaacggctatttttcgcaagataaa
aaaggcgtggcgaaagataccaacggcaccacgcaagtggacaatgacacttatcagctg
attatgcgagataaagaaaaattgctttctttggataatccgttgcgttttattttttct
cattccgccttgcgagaaggttgggataacccgaatgtgtttcaaatttgcaccttaaac
gacactgcaagcgaaatgaaaaaacgccaagaaattgggcggggcttgcgactgccggtt
aatcagcatgggcagcgtatttatgatcgcgctcaaagtacgctcacggtaattgccaat
gaaagttatgaacaatttgcggcaacgttacaacgtgaaattgaagaagattgtggcgtg
aaattcgctaaaagtcatattaaaaaacgggaagataaacgagaagtacgttatcgcaaa
gatttcagtttgcaccctgattttgtagcaatttgggagcgcattaagcagcaaaccact
tatcgagtaaatttcagtaacgatgaattgattgaacgtgcggtggaaaaaatccacaaa
atgccagccattgaagcgactaaaattaaacacgctaaagcgaaattggtcattgatgaa
agcggtattgcgaccgattatcgtgcggcaggcgaaacaaccgtccattcgcaatgggca
attcctgcgttactgaatgaattgcaaaagaaaacgggacttacccgaataaccctttgc
aaaattttgcaacaatctgaccgcttgcaagaggtgtttcgtaatccgcaacgttttata
gatttggtggcggaaaaaatcaatgcggtattgcaacttattatggcagacggcatcgag
tatcgaaaaattgccgggaaaagttatgaaatgacgttgttcagggattttgagttttat
gccaacccatatactttcgccgtaaacgataaaacgaaaaccatttatgaagattgtatt
tcgctggactccaccaccgaatatacctttgccaaacattgcgaaagcagcgaagacatt
gaattttattttaaattgcctgaacgtttcaaaatccccactccgttgggtaattacaat
cctgactgggcagtggtgtttaaaggagaaaataaaatctattttgttgccgaaaccaaa
aataccggcaaaggtattcaaagtggcgtagatgaagacaaattacgtgaaaatgagcag
ctgaaaattgcctatgcccgtaagaatttccactatttacgcttggattatccggatttg
gattatcaagtggtggagaacgtcgaggaattatcgggtcagtatcgaaatcttagataa

DBGET integrated database retrieval system