KEGG   Actinobacillus succinogenes: Asuc_0677Help
Entry
Asuc_0677         CDS       T00558                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asuc_0677 (tpiA)
   01230 Biosynthesis of amino acids
    Asuc_0677 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0677 (tpiA)
   00051 Fructose and mannose metabolism
    Asuc_0677 (tpiA)
   00562 Inositol phosphate metabolism
    Asuc_0677 (tpiA)
Enzymes [BR:asu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Asuc_0677 (tpiA)
Exosome [BR:asu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Asuc_0677 (tpiA)
  Exosomal proteins of bladder cancer cells
   Asuc_0677 (tpiA)
  Exosomal proteins of melanoma cells
   Asuc_0677 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(737797..738567)
Genome map
AA seq 256 aa AA seqDB search
MASRKPLVMGNWKLNGSKAFTRELIEGLKTELAGVEGCDVAIAPPVMYLAEAETALADSK
IALGSQNVDVNVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFIAKKFSALKE
AGLTPVLCIGETEEENEAGKTEEVVSRQIDAVINALGVEAFNGAVIAYEPIWAIGTGKSA
TPAQAQAVHAFIRAHIAAKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLK
APAFAVIVKAAAAAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcgtaaaccattagtaatgggtaactggaaattaaacggcagtaaagcgttc
accagagaattaatcgaaggcttaaaaaccgaactggccggcgtagaaggctgtgacgtc
gctatcgcaccgccggtaatgtacttggctgaagcggaaaccgcgcttgccgacagcaaa
atagccttaggttcacaaaatgtggacgtaaacgtaaaaggcgcgttcaccggtgacatc
tctaccgaaatgttaaaagatttcggtgcgaaatatatcattatcggtcattccgagcgc
cgtacttatcacaaagaaagtgacgaattcatcgcgaaaaaattctccgccttaaaagaa
gcgggtttaaccccggttttatgtatcggtgaaaccgaagaggaaaatgaagcgggcaaa
acggaagaagtggtttcccgtcaaattgatgccgtcatcaacgctttaggcgtagaagcc
tttaacggtgcggttatcgcttatgaaccgatttgggcaatcggtaccggcaaatccgcc
actccggctcaggcacaagcggtgcatgcttttattcgcgctcatattgcggcgaaatct
caagcggtagcggatcaagtcatcatccaatacggcggttccgtaaacgatgcaaacgca
gccgaactgttcacacaaccggatattgacggtgcattagtgggcggcgcgtcattaaaa
gctcccgcgttcgcagtaatcgtaaaagccgcggcggcagcgaaggcttaa

DBGET integrated database retrieval system