KEGG   Actinobacillus succinogenes: Asuc_0687Help
Entry
Asuc_0687         CDS       T00558                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00010  Glycolysis / Gluconeogenesis
asu00030  Pentose phosphate pathway
asu00051  Fructose and mannose metabolism
asu00052  Galactose metabolism
asu00680  Methane metabolism
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01130  Biosynthesis of antibiotics
asu01200  Carbon metabolism
asu01230  Biosynthesis of amino acids
asu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0687
   00030 Pentose phosphate pathway
    Asuc_0687
   00051 Fructose and mannose metabolism
    Asuc_0687
   00052 Galactose metabolism
    Asuc_0687
  Energy metabolism
   00680 Methane metabolism
    Asuc_0687
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Asuc_0687
Enzymes [BR:asu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Asuc_0687
Protein phosphatases and associated proteins [BR:asu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Asuc_0687
Messenger RNA biogenesis [BR:asu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Asuc_0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABR74060
UniProt: A6VM63
Position
complement(746413..747378)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRAVVRAGLSEGLEVYGVFDGYQGLFENRIQKLSRYSVSD
VINRGGTFLGSARFPEFKQPEVRSKCAEILHSHGIDALVVIGGDGSYTGAKLLTEEHGFP
CIGLPGTIDNDIPGTDYTIGYQTALETAVDAIDRLRDTSGSHHRISIVEIMGRHCSDLTI
CAAIAGGCEYIVAPEVGFNQEELIQQIELSLANGKRHAIIAITELVTDVHKLAKDIEARV
GNETRATVLGHVQRGGSPCAFDRILASRMGVYAVELLLQGHKGRCVGIQQEKLVHHDIIE
AIDSMRRPFKSDYLEVSKKLF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattgcagtcttaacaagtggtggtgacgcaccgggaatgaatgccgca
attcgtgccgtggtacgtgcgggattatccgaaggattagaagtatacggtgttttcgac
ggttaccaaggactttttgagaaccgtattcaaaaactttcgcgctatagcgtgtccgat
gtcattaaccgcggcggaacgtttttaggttccgcccgattccctgaattcaaacaaccg
gaagtgcggtcgaaatgcgccgaaattttacactcgcacggcattgacgctttagtggtt
atcggcggtgacggttcttataccggtgcaaaattattaacggaagaacacggtttccct
tgtatcggcttgccgggtacgatagataacgatattccgggcaccgactacaccatcggt
tatcaaaccgcattggaaaccgccgttgacgccatcgaccgcttgcgcgataccagcggt
tctcaccatcgtatttccattgtggaaatcatggggcgacactgcagcgatttaaccatt
tgtgcggcaatcgccggcggctgcgaatatatcgtcgcaccggaagtcggattcaatcag
gaagaattaatccaacaaatcgaactcagtcttgccaacggtaaacgtcatgcgattatc
gccattaccgaattagtcacggacgtacacaaattagccaaagatattgaagctcgggtc
ggcaacgaaacccgtgcaaccgtgttaggccacgtacaacgcggcgggtccccttgcgct
tttgaccgtattttagcctcccgcatgggcgtgtacgcagtagaattattgctgcaaggt
cacaaaggacgctgcgtgggtatccagcaggaaaaactggtacatcacgacatcatcgaa
gccattgacagtatgcgccgtccgtttaaatccgattacctggaagtatccaaaaaatta
ttctaa

DBGET integrated database retrieval system