KEGG   Actinobacillus succinogenes: Asuc_0687Help
Entry
Asuc_0687         CDS       T00558                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asuc_0687
   01230 Biosynthesis of amino acids
    Asuc_0687
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0687
   00030 Pentose phosphate pathway
    Asuc_0687
   00051 Fructose and mannose metabolism
    Asuc_0687
   00052 Galactose metabolism
    Asuc_0687
  Energy metabolism
   00680 Methane metabolism
    Asuc_0687
Enzymes [BR:asu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Asuc_0687
Protein phosphatases and associated proteins [BR:asu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Asuc_0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(746413..747378)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRAVVRAGLSEGLEVYGVFDGYQGLFENRIQKLSRYSVSD
VINRGGTFLGSARFPEFKQPEVRSKCAEILHSHGIDALVVIGGDGSYTGAKLLTEEHGFP
CIGLPGTIDNDIPGTDYTIGYQTALETAVDAIDRLRDTSGSHHRISIVEIMGRHCSDLTI
CAAIAGGCEYIVAPEVGFNQEELIQQIELSLANGKRHAIIAITELVTDVHKLAKDIEARV
GNETRATVLGHVQRGGSPCAFDRILASRMGVYAVELLLQGHKGRCVGIQQEKLVHHDIIE
AIDSMRRPFKSDYLEVSKKLF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattgcagtcttaacaagtggtggtgacgcaccgggaatgaatgccgca
attcgtgccgtggtacgtgcgggattatccgaaggattagaagtatacggtgttttcgac
ggttaccaaggactttttgagaaccgtattcaaaaactttcgcgctatagcgtgtccgat
gtcattaaccgcggcggaacgtttttaggttccgcccgattccctgaattcaaacaaccg
gaagtgcggtcgaaatgcgccgaaattttacactcgcacggcattgacgctttagtggtt
atcggcggtgacggttcttataccggtgcaaaattattaacggaagaacacggtttccct
tgtatcggcttgccgggtacgatagataacgatattccgggcaccgactacaccatcggt
tatcaaaccgcattggaaaccgccgttgacgccatcgaccgcttgcgcgataccagcggt
tctcaccatcgtatttccattgtggaaatcatggggcgacactgcagcgatttaaccatt
tgtgcggcaatcgccggcggctgcgaatatatcgtcgcaccggaagtcggattcaatcag
gaagaattaatccaacaaatcgaactcagtcttgccaacggtaaacgtcatgcgattatc
gccattaccgaattagtcacggacgtacacaaattagccaaagatattgaagctcgggtc
ggcaacgaaacccgtgcaaccgtgttaggccacgtacaacgcggcgggtccccttgcgct
tttgaccgtattttagcctcccgcatgggcgtgtacgcagtagaattattgctgcaaggt
cacaaaggacgctgcgtgggtatccagcaggaaaaactggtacatcacgacatcatcgaa
gccattgacagtatgcgccgtccgtttaaatccgattacctggaagtatccaaaaaatta
ttctaa

DBGET integrated database retrieval system