KEGG   Actinobacillus succinogenes: Asuc_0803Help
Entry
Asuc_0803         CDS       T00558                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Asuc_0803
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asuc_0803
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Asuc_0803
Enzymes [BR:asu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Asuc_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
862403..863677
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEERVNFAQAVRQGLGKDQGLFFPEVIPQLDNVDALLDLPLVERSQKILGAV
IGDEIPTEKLNAMVKNAFTFPAPLAKVNENIYALELFHGPTLAFKDFGARFMAQALATVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAV
NSDFDACQALVKQAFDDEALRQAIGLNSANSINISRLLAQICYYFEAVAQLPKEKRKDIV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLADGKWEPHATVATLSNAMD
VSRPNNWPRVEELFKRNGWNLKELASAGLNDAETEAALKAEYAEGYLCEPHGAIAYQALK
DQLQAGETGIFLCTAHPAKFKESVERILNIELPLPEALDKHNKLPLLSDEMEPDFAALRA
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatctatacaacatcaaacaccctgaagaacgcgtgaatttcgcccaagcggtgcgt
caggggctgggcaaagaccagggcttgttttttcccgaagtgattccgcaattagacaac
gttgacgctttattggatctcccgttggtggaacgcagtcagaaaattttaggcgccgtt
atcggtgacgaaatcccgacggaaaaattaaacgccatggtgaagaatgcttttactttc
ccggcaccgctggcgaaagtgaatgaaaatatttacgctttggaattattccacggaccg
acactggcgttcaaagatttcggcgctcgctttatggcgcaggctttagccacggtgcgc
ggcgacggtaaaattactattttgacggcgacttcgggcgataccggcgcggcggtcgcg
catgctttctacggattggaaaatattaacgtagtgattttgtatccgaaaggcaaaatc
agcccgttacaggaaaaattattctgcacgctcggcgggaatattcgtaccgttgccgtg
aattcggatttcgacgcctgtcaggcattagtgaaacaagcctttgacgacgaagcgtta
cggcaagcaatcggtttgaattccgccaattctattaacatcagccgtttattggcgcaa
atttgttattattttgaagcggtcgctcaattaccgaaagaaaaacgcaaagacatcgta
gtgtccgtgccaagcggtaatttcggcaacttaaccgccggtttaattgcgaaaacttta
gggctgccgattaagcgttttatcgcctctaccaatgccaacgacaccgtgccgcgttat
ttagccgacggtaagtgggaaccccatgcaacggtcgccactctgtccaacgctatggac
gtcagccgtcccaacaattggccgcgtgtggaagaattgttcaagcgcaacggttggaat
ttgaaagagttggcttccgccggcttgaacgatgcggaaacggaagccgccttaaaagcg
gaatatgcggaaggttatctgtgcgaaccgcacggcgccattgcttatcaagccttgaaa
gatcaacttcaggcgggtgaaacgggtatttttttatgtaccgcccatccggcgaaattc
aaagaaagcgtcgaacgcattctgaatatcgaattgccgttaccggaagccttggacaaa
cacaataaattaccgttgctttccgatgaaatggagccggatttcgccgcattgcgcgca
tatctgctgaaataa

DBGET integrated database retrieval system