KEGG   Actinobacillus succinogenes: Asuc_0803Help
Entry
Asuc_0803         CDS       T00558                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00260  Glycine, serine and threonine metabolism
asu00750  Vitamin B6 metabolism
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01230  Biosynthesis of amino acids
Module
asu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asuc_0803
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Asuc_0803
Enzymes [BR:asu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Asuc_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABR74173
UniProt: A6VMH6
Position
862403..863677
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEERVNFAQAVRQGLGKDQGLFFPEVIPQLDNVDALLDLPLVERSQKILGAV
IGDEIPTEKLNAMVKNAFTFPAPLAKVNENIYALELFHGPTLAFKDFGARFMAQALATVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAV
NSDFDACQALVKQAFDDEALRQAIGLNSANSINISRLLAQICYYFEAVAQLPKEKRKDIV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLADGKWEPHATVATLSNAMD
VSRPNNWPRVEELFKRNGWNLKELASAGLNDAETEAALKAEYAEGYLCEPHGAIAYQALK
DQLQAGETGIFLCTAHPAKFKESVERILNIELPLPEALDKHNKLPLLSDEMEPDFAALRA
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatctatacaacatcaaacaccctgaagaacgcgtgaatttcgcccaagcggtgcgt
caggggctgggcaaagaccagggcttgttttttcccgaagtgattccgcaattagacaac
gttgacgctttattggatctcccgttggtggaacgcagtcagaaaattttaggcgccgtt
atcggtgacgaaatcccgacggaaaaattaaacgccatggtgaagaatgcttttactttc
ccggcaccgctggcgaaagtgaatgaaaatatttacgctttggaattattccacggaccg
acactggcgttcaaagatttcggcgctcgctttatggcgcaggctttagccacggtgcgc
ggcgacggtaaaattactattttgacggcgacttcgggcgataccggcgcggcggtcgcg
catgctttctacggattggaaaatattaacgtagtgattttgtatccgaaaggcaaaatc
agcccgttacaggaaaaattattctgcacgctcggcgggaatattcgtaccgttgccgtg
aattcggatttcgacgcctgtcaggcattagtgaaacaagcctttgacgacgaagcgtta
cggcaagcaatcggtttgaattccgccaattctattaacatcagccgtttattggcgcaa
atttgttattattttgaagcggtcgctcaattaccgaaagaaaaacgcaaagacatcgta
gtgtccgtgccaagcggtaatttcggcaacttaaccgccggtttaattgcgaaaacttta
gggctgccgattaagcgttttatcgcctctaccaatgccaacgacaccgtgccgcgttat
ttagccgacggtaagtgggaaccccatgcaacggtcgccactctgtccaacgctatggac
gtcagccgtcccaacaattggccgcgtgtggaagaattgttcaagcgcaacggttggaat
ttgaaagagttggcttccgccggcttgaacgatgcggaaacggaagccgccttaaaagcg
gaatatgcggaaggttatctgtgcgaaccgcacggcgccattgcttatcaagccttgaaa
gatcaacttcaggcgggtgaaacgggtatttttttatgtaccgcccatccggcgaaattc
aaagaaagcgtcgaacgcattctgaatatcgaattgccgttaccggaagccttggacaaa
cacaataaattaccgttgctttccgatgaaatggagccggatttcgccgcattgcgcgca
tatctgctgaaataa

DBGET integrated database retrieval system