KEGG   Actinobacillus succinogenes: Asuc_0832Help
Entry
Asuc_0832         CDS       T00558                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
asu  Actinobacillus succinogenes
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:asu00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:asu00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
892383..892925
Genome map
AA seq 180 aa AA seqDB search
MKIIETKIPEVKLLEPTVLGDERGFFMETFRDEWFKQNVADRTFVQENHSKSVKGVLRGL
HYQTENTQGKLVRVVQGEVFDVAVDMRKSSPTFGQWVGEILSAENKRQLWVPEGFAHGFY
VLSETAEFTYKCTDYYNPKAEHSLLWNDPTVGIMWNLVGEPSLSTKDLAGKLLKDAVLFD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatagaaacaaaaatccctgaagtgaaattattagaaccgacggtattgggg
gatgaacgtggtttctttatggaaacctttcgtgatgaatggtttaaacaaaatgttgct
gaccgcacttttgtgcaggaaaatcattcaaaatcagtaaaaggtgtattgcgaggtttg
cattaccaaacggaaaatacccaaggcaaattagtccgcgtggtgcagggggaagtgttt
gatgtggcagtggatatgcgtaaaagctcgccgacattcgggcaatgggtcggtgaaatt
ctttctgctgaaaataaacgccaactttgggtgccggaaggctttgcccatggtttttat
gtgctgagtgaaacggctgaatttacttataaatgtacggattattacaacccaaaagca
gagcattcattattgtggaatgatccgacagtcgggattatgtggaatttggttggcgaa
ccgagtttatcgacaaaagatcttgccggcaaattgctcaaagacgcggttttatttgat
taa

DBGET integrated database retrieval system