KEGG   Actinobacillus succinogenes: Asuc_0943Help
Entry
Asuc_0943         CDS       T00558                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00010  Glycolysis / Gluconeogenesis
asu00020  Citrate cycle (TCA cycle)
asu00620  Pyruvate metabolism
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01130  Biosynthesis of antibiotics
asu01200  Carbon metabolism
Module
asu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0943
   00020 Citrate cycle (TCA cycle)
    Asuc_0943
   00620 Pyruvate metabolism
    Asuc_0943
Enzymes [BR:asu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Asuc_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 GCV_H HlyD_3 NQRA Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ABR74311
UniProt: A6VMW4
Position
1010343..1012226
Genome map
AA seq 627 aa AA seqDB search
MSKQIQIPDIGADEVTVTEVMVNVGDIVEVDQSIINVEGDKASMEVPSPETGVVKELLVK
VGDKVTTGTPMFILEAAGSASAAPTPQAEVAPAAAPAVAEVKDVHVPDIGGDEVNVTEIM
VKVGDTVTEEQSLITVEGDKASMEVPAPFAGVVKEISVKSGDKVSTGSLIMKFEVAGSAP
AATVDQPAVAAPAASAAAAVKDVNVPDIGGDEVNVTEIMVKVGDTVTEEQSLITVEGDKA
SMEVPAPFAGVVKEIIVKSGDKVSTGSLIMRFEVAGAAPAAAPAPVSQPAAAVPAAQSAP
AAAPVSAPAASQDAVTSSATFVHATPVVRRLAREFGVNLDKVKGTGRKGRILKEDVQEYV
KNALKQLESGAATGAANGAGLGLLPWPKVDFSKFGEVEEIELTRINKISGANLHRNWVMI
PHVTHFDRADITDLEAFRKEQNALAEKQKLGVKITPVVFIMKAVAKALEAFPRFNSSITE
DAQRLILKKYINVGVAVDTPNGLVVPVFKDVNKKGIIELSRELMEVSKKAREGKLTASDM
QGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSEMAPVWNGKEFMPRLMLPLSLSFDH
RVIDGADGARFITFINGVLSDLRRLAM
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaaattccagatattggtgcggatgaagttacggttactgaagtg
atggtaaacgtgggtgatatcgttgaagtcgatcaatcgattattaatgtagaaggcgat
aaggcatcaatggaagttccttctccggaaaccggcgtcgtgaaagaattattagtgaaa
gtcggtgataaagtcaccaccggcactccgatgtttatattggaagccgcaggttcagcc
tccgcagcacctacaccccaggccgaagtcgctccggcagcggcacctgcagttgccgaa
gtgaaagatgtgcacgtaccggatatcggcggtgacgaagtcaacgtaaccgaaatcatg
gtaaaagtcggcgacacggtgacggaagaacaatcattaatcaccgttgaaggcgataaa
gcgtcaatggaagtaccggcgccgtttgccggcgtggtgaaagaaatcagcgtgaaatcc
ggcgataaagtgtcaaccggttcattaatcatgaaattcgaagtagcgggttccgcacct
gcggctacagttgatcaacctgcggtagcggctccggcggcatctgcagcggccgcggta
aaagatgttaacgtaccggatatcggcggtgacgaagtcaacgtaaccgaaatcatggta
aaagtcggcgacacggtgacggaagaacaatcattaatcaccgttgaaggcgataaagcg
tcaatggaagtaccggcaccgtttgccggcgtggtaaaagaaattatcgtgaaatccggc
gataaagtgtcaaccggttcattaattatgcgctttgaagtagcgggagcagcgccagca
gccgcacctgcaccggtatctcaacctgcggcagcggttccggcggcacaatccgcacct
gccgccgcccctgtatccgcgccggcagccagtcaggatgcggtaacatcaagcgcaaca
tttgtccatgcaacaccggtcgttcgtcgtttagcgcgtgaattcggcgtgaatctggat
aaagtaaaaggtaccggtcgtaagggacgtatcttgaaagaagacgttcaggaatatgtg
aaaaatgcccttaaacaactggaaagcggtgctgcgacaggtgcggcaaatggcgccggt
ttaggcttgttgccatggccgaaagtcgatttcagcaaattcggcgaagtagaagaaatc
gaattgacccgtatcaacaagatctccggtgcaaatctgcatcgtaactgggtgatgatt
cctcatgtaacccactttgatcgcgcggacattacggatttagaagcgttccgtaaagaa
caaaatgctttagcggaaaaacaaaaactgggtgtgaaaattacaccggttgtgtttatt
atgaaagcggtggcaaaagccttagaagcgttcccgcgtttcaacagctcaattaccgaa
gatgcgcaacgtctgattctgaaaaaatatatcaatgtcggcgtagcggtggatacaccg
aacggtttagtggtacctgtatttaaagatgttaacaaaaaaggcattatcgaactttcc
cgcgaattgatggaagtttcgaaaaaagcccgtgagggtaaattaaccgcatccgatatg
caaggcggttgtttcaccatttccagtatcggcggtttgggtacgactcactttgcaccg
attgttaatgcgcctgaagtggcaattttaggggtatctaaatccgaaatggctccggtg
tggaacggtaaagaatttatgccgcgcttaatgcttccgttgtcattatctttcgaccac
cgagtgatcgacggtgcggacggtgcacgctttattacttttattaacggtgtgctttcc
gacttacgtcgcttagccatgtaa

DBGET integrated database retrieval system