KEGG   Actinobacillus succinogenes: Asuc_0973Help
Entry
Asuc_0973         CDS       T00558                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_0973
Enzymes [BR:asu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Asuc_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1044204..1045673)
Genome map
AA seq 489 aa AA seqDB search
MSSLKPFPTDFLWGGATAANQIEGGFDQGGKGLSSADMVAYVPKAERGAHSAAIEVGSQR
IDDILSGKFRARFPKREGIDFYHKYKDDIALFGEMGFKMFRISIHWARIFPNGYDEQPNE
AGLQYYDDMFDEMLKHGIQPMVTLCHYEIPLGLVQKYNGFVSREVVGHFVRYAETVFNRY
KEKVKYWLTFNEINMITMHSPYTGGGIVLDRIPEAERENAKYQALHHQFVASALATKALH
EIIPDAKMGCMLARQLHYALTADPQDQRLAQWGNQQNLFFTDVHVRGEYPRYMLRHWAEN
NVHIQKEAGDDAVLKQYPVDFISFSYYMSVCVTTHDEGEKVGGNLIEGVRNPYLTVSDWG
WQIDPVGLRITLNDLYDRYQKPLFIVENGLGAYDKVEADGAIHDSYRIDYLRSHIAQMQE
AISDGVELLGYLEWGPIDLVSMSTSEMSKRYGFIYVDIDDDGNGTGKRSPKDSFYWYKKV
IASNGADLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcttaaaaccatttccaaccgattttttatggggcggagccaccgcagccaac
caaattgaaggtggctttgatcaaggtggaaaagggttatcatcggcagatatggtagcc
tatgtaccgaaagcggaacgaggcgcccacagtgcggcgattgaggtcggttcacagcgt
attgacgatattttatccggtaaattccgagcccgtttcccaaaacgggaggggatagat
ttctatcataaatataaagacgatatcgccctgtttggtgaaatgggctttaaaatgttc
cgtatttccattcattgggcgcgcattttcccgaacggatatgacgagcaaccgaatgaa
gcgggtttacaatattacgacgatatgttcgatgaaatgctcaaacacggcattcagccg
atggtaacgctatgccattatgaaatcccgcttggtttggtgcaaaaatataacggcttc
gtttcacgcgaagtggtcgggcattttgtgcgctatgccgagacagtatttaaccgttat
aaagaaaaagtaaaatattggctgacttttaatgaaatcaatatgattacaatgcacagc
ccctacaccggcggcggaatcgtgcttgatcgtattccggaagcagaacgtgaaaatgcg
aaatatcaagcacttcaccatcaatttgtcgctagtgcattagccaccaaagccctgcac
gagatcattcctgatgcgaaaatgggttgtatgttagctcgccaacttcactatgcttta
accgcagatccgcaagatcagcgtttggctcaatggggcaatcaacaaaacttattcttt
actgatgtacacgttcgtggcgaatatccacgctatatgttacgccactgggcggaaaac
aatgtgcatatccaaaaagaagcaggtgatgatgccgttttaaaacagtatcctgtcgat
tttatttcttttagctactatatgtcggtttgtgtaacaacgcatgacgaaggggaaaaa
gtaggtggtaacttaattgaaggggtaagaaatccgtatcttaccgtttcggattggggc
tggcaaatcgaccctgtcgggttgcgtattaccctaaacgacttatatgatcgctaccaa
aaaccgctttttattgtggaaaacggattaggtgcttacgacaaagtcgaagcggacggg
gctattcacgacagctaccgtattgattatctccgctctcacatcgctcaaatgcaagaa
gcgatcagtgatggcgttgagttactcggttatttggaatggggtccgattgaccttgtc
agtatgtctacctcggagatgtcaaaacgctacggatttatttacgttgatattgacgat
gacggcaacggcaccggtaaacgttcgccgaaagactctttctattggtataaaaaagtg
attgcatcaaacggtgcggatctgtcttaa

DBGET integrated database retrieval system