KEGG   Actinobacillus succinogenes: Asuc_0973Help
Entry
Asuc_0973         CDS       T00558                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:asu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1044204..1045673)
Genome map
AA seq 489 aa AA seqDB search
MSSLKPFPTDFLWGGATAANQIEGGFDQGGKGLSSADMVAYVPKAERGAHSAAIEVGSQR
IDDILSGKFRARFPKREGIDFYHKYKDDIALFGEMGFKMFRISIHWARIFPNGYDEQPNE
AGLQYYDDMFDEMLKHGIQPMVTLCHYEIPLGLVQKYNGFVSREVVGHFVRYAETVFNRY
KEKVKYWLTFNEINMITMHSPYTGGGIVLDRIPEAERENAKYQALHHQFVASALATKALH
EIIPDAKMGCMLARQLHYALTADPQDQRLAQWGNQQNLFFTDVHVRGEYPRYMLRHWAEN
NVHIQKEAGDDAVLKQYPVDFISFSYYMSVCVTTHDEGEKVGGNLIEGVRNPYLTVSDWG
WQIDPVGLRITLNDLYDRYQKPLFIVENGLGAYDKVEADGAIHDSYRIDYLRSHIAQMQE
AISDGVELLGYLEWGPIDLVSMSTSEMSKRYGFIYVDIDDDGNGTGKRSPKDSFYWYKKV
IASNGADLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcttaaaaccatttccaaccgattttttatggggcggagccaccgcagccaac
caaattgaaggtggctttgatcaaggtggaaaagggttatcatcggcagatatggtagcc
tatgtaccgaaagcggaacgaggcgcccacagtgcggcgattgaggtcggttcacagcgt
attgacgatattttatccggtaaattccgagcccgtttcccaaaacgggaggggatagat
ttctatcataaatataaagacgatatcgccctgtttggtgaaatgggctttaaaatgttc
cgtatttccattcattgggcgcgcattttcccgaacggatatgacgagcaaccgaatgaa
gcgggtttacaatattacgacgatatgttcgatgaaatgctcaaacacggcattcagccg
atggtaacgctatgccattatgaaatcccgcttggtttggtgcaaaaatataacggcttc
gtttcacgcgaagtggtcgggcattttgtgcgctatgccgagacagtatttaaccgttat
aaagaaaaagtaaaatattggctgacttttaatgaaatcaatatgattacaatgcacagc
ccctacaccggcggcggaatcgtgcttgatcgtattccggaagcagaacgtgaaaatgcg
aaatatcaagcacttcaccatcaatttgtcgctagtgcattagccaccaaagccctgcac
gagatcattcctgatgcgaaaatgggttgtatgttagctcgccaacttcactatgcttta
accgcagatccgcaagatcagcgtttggctcaatggggcaatcaacaaaacttattcttt
actgatgtacacgttcgtggcgaatatccacgctatatgttacgccactgggcggaaaac
aatgtgcatatccaaaaagaagcaggtgatgatgccgttttaaaacagtatcctgtcgat
tttatttcttttagctactatatgtcggtttgtgtaacaacgcatgacgaaggggaaaaa
gtaggtggtaacttaattgaaggggtaagaaatccgtatcttaccgtttcggattggggc
tggcaaatcgaccctgtcgggttgcgtattaccctaaacgacttatatgatcgctaccaa
aaaccgctttttattgtggaaaacggattaggtgcttacgacaaagtcgaagcggacggg
gctattcacgacagctaccgtattgattatctccgctctcacatcgctcaaatgcaagaa
gcgatcagtgatggcgttgagttactcggttatttggaatggggtccgattgaccttgtc
agtatgtctacctcggagatgtcaaaacgctacggatttatttacgttgatattgacgat
gacggcaacggcaccggtaaacgttcgccgaaagactctttctattggtataaaaaagtg
attgcatcaaacggtgcggatctgtcttaa

DBGET integrated database retrieval system