KEGG   Actinobacillus succinogenes: Asuc_1297Help
Entry
Asuc_1297         CDS       T00558                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Asuc_1297
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asuc_1297
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Asuc_1297
Enzymes [BR:asu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Asuc_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1444653..1445747)
Genome map
AA seq 364 aa AA seqDB search
MKFICNQCHQTAPVSTRQAKCQCGGLWTLDYHPPKFDLNDIDRHEWSLFRYRKFIALQDE
SWRGISLGEGMTPIVRFDDNVLLKMDYFMPTLSFKDRGAAVLISHCKAIGVDSVVQDSSG
NAGNSVAAYCAKAGIQCEIFVPEGTSPKKINMIEAHGAKANVIAGSRDHCADVCRAKVEN
EGIYYANHVYNPFFYEGTKTYIYETFEQLGRIPKHIVVPVGNGTLFIGVIKGLEHLLASG
AINEMPTIIALQSEHCDPLLQAVEKGQKFAENVEVKPTIAEGIAIGQPMRAAEILTYAEK
YPVRFVHAPEDKILAARDILAKKGVYCEHTTAANYAAYLRYCELYGTAEDCLITMCGAGL
KSDH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatctgcaaccaatgccatcaaaccgcaccggtttccacccgccaggccaaa
tgccaatgcggcggcttgtggacgctggattatcacccgccgaaattcgatcttaacgac
atcgaccgccatgaatggagcctgttccgttatcgtaaatttattgccttgcaagacgaa
tcttggcgtggcatttcccttggcgaagggatgaccccgattgtgcggtttgatgataac
gtcttgttaaaaatggattattttatgccgaccctttcttttaaagatcgcggcgcggcg
gtgctgatcagccattgcaaagccatcggcgtggattcggtggtgcaggacagcagcggc
aatgcgggcaacagcgtggcggcatattgtgctaaagcgggtattcaatgtgaaattttc
gtgccggaaggcacttcgccgaagaaaatcaatatgattgaagcccacggcgccaaagcc
aatgtgattgccggcagccgcgaccactgcgccgacgtgtgccgagccaaggtggaaaat
gaaggcatttactatgcgaaccacgtttacaacccgttcttctacgaaggcaccaaaact
tatatttacgaaaccttcgaacagctcggacgcattccgaagcacatcgtggtaccggtg
ggcaacggcaccctgtttatcggtgtgattaaaggcttggaacacttattggcaagcggc
gcgataaacgaaatgccgactatcatcgccctgcaaagcgagcattgcgacccgctgtta
caagcggtcgaaaaaggacaaaaatttgcagaaaacgtcgaggtcaaaccgaccatcgcc
gaaggcatcgccatcggacaaccgatgcgagccgcggaaattttaacctatgcggaaaaa
taccccgtccgcttcgtgcatgcgccggaagataaaatcctcgccgcccgtgatattttg
gcgaaaaaaggcgtgtactgcgaacacaccaccgccgcaaattatgccgcctatctccgc
tactgcgaactttacggcacggcggaagactgcctgatcaccatgtgcggcgccgggctg
aaatcggatcactaa

DBGET integrated database retrieval system