KEGG   Actinobacillus succinogenes: Asuc_1398Help
Entry
Asuc_1398         CDS       T00558                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
asu  Actinobacillus succinogenes
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:asu00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:asu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1550763..1553786
Genome map
AA seq 1007 aa AA seqDB search
MILPTYFENPEILQVNRQPHHAYFIPFATNQSPDQSARKTSRFFTSLSGKTWDFSYYDSV
QNLPENFLFCSLQNSIPVPSNWQTQGFDHHHYTNIQYPFPFDPPFVPKANPCAHYRHEFN
FSPKTDKRYLLNLEGVDSCLFVYVNQQFVGYGQISHCTQEFDITEHLNSGKNVLDVVVLK
WCDGSYLEDQDKFRMSGIFRDVYLLERDANYLQDFFIKTQLSDDFNQAEFTVETQFSDKE
REIEFILYNPQGEEIVRQSAVKFSHVLFNPVLWNAENPRLYRLTMQVGNEIIEQKIGLRK
IYIENGVLKINGQAVKFKGVNRHDSDPKTGYVISYEQALVDLKLMKRHNINAIRTAHYPN
APWFSELCDLYGFYLIAESDIESHGASMLYVDTPEQSIFLNNQRINRDEEIRQQVIDNFC
YFARAPEYKAAILDRTAANIERDKNRTSVLIWSLGNESGYGENFEAAAAWVKQRDNSRLI
HYESSIYQHSQHQNDLSNLDFYSEMYPGTESLDAYCTTDENTKPYILCEYSHAMGNSNGD
AEDYWQTFEKYDKSCGGFVWEWCDHAPYLPDGSGRMGYGGDFGDTPNDGNFCMDGLVSPT
RIPHSNLFELKNVNRPIRARLVGNRIEVKNYWDFTHLDETVTICYAVKENGEIIEQGECK
VKCAPKQTALLPLTLPDYHGKFTTLDLEYLAATQSALLEPNHCYGFEQLVIYDKDLVSPQ
KPEKPTALFPFAVVESARRLTVKNGDYQYIFDKDCGIFTEILRKEKALIEQPLHFNIWRA
PTDNDRLIRELWQNAGYHQTYSRAYSVTWQQTESAVVIQAILAIVATAKNRILTLQVNYT
LYQNGQLTIEAHGERPAHLPYLPRFGLRFFLPKTCEQAQYFGYGERESYSDKHHLARLGN
YAVNAAQNHVRYLKPQENGSHLGCHYVRLGHCLVYSPLPFSFNLSPYTQEELTAKNHDYE
LEECDSTVLCIDYKMSGIGSNSCGPALKPQYRLQETKFDCRFDIHFE
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgattctgccaacctactttgaaaatcctgaaatattgcaggttaaccgtcaacctcat
catgcgtactttattccctttgcgaccaatcagtcgccggatcagtcagcacgcaaaaca
tcacgattttttacctcactttccggcaaaacctgggatttcagctattacgacagcgta
cagaatttaccggaaaatttcctgttttgctctctgcaaaacagcattcccgtgccatcc
aactggcaaactcaaggatttgatcaccatcattatactaatattcaataccctttccct
ttcgatccgccttttgtaccgaaagctaatccctgcgctcattatcggcatgaatttaat
ttttcgccgaaaacggataagcgttatctgttaaatttagaaggcgtggacagctgcctg
tttgtctatgtaaatcaacagtttgtgggttacggacaaatcagtcattgcacccaggaa
tttgatattaccgaacacctgaactcgggtaaaaatgtattggatgtggtcgtactgaaa
tggtgtgacggcagttacctggaggatcaggataaattccgtatgtcgggtatcttccga
gatgtgtatttattggaacgggatgcgaactatttgcaggatttcttcatcaaaacgcaa
ttatccgatgattttaaccaagctgaattcactgtagaaactcaattttcagacaaggaa
cgagaaatagaattcatcctttataatcctcagggggaagaaatagtacgccaaagtgcg
gtcaaattttcacatgttttattcaatcctgttttatggaatgcggaaaatccccggctt
taccgcttgaccatgcaagtaggtaacgaaattatcgaacaaaaaataggcttgcgtaaa
atttacattgaaaacggcgtactgaaaattaacggacaggcggttaaatttaaaggcgtc
aaccgccacgacagcgatccgaaaacaggctatgtaatttcatatgagcaggcgttagtt
gatttgaaattgatgaaacgacacaacattaatgccattcgtaccgctcactaccctaat
gctccatggttcagcgaactgtgtgatttatacggtttctatttaatagcggaaagcgac
atcgaaagccacggagccagcatgctttatgtggatacgccggaacaaagtatttttctg
aacaatcaacgaattaatcgcgacgaagaaatacgtcaacaggttatcgacaatttttgt
tattttgcccgtgcgccggaatataaagcggctattttagaccgcacggctgccaatatc
gaacgggataaaaaccgtacttccgtgttaatttggtctcttggtaatgaaagcggatat
ggtgaaaacttcgaagccgccgccgcttgggttaaacagcgagacaattctcgtctaatc
cattacgaaagttctatttatcagcacagccaacatcaaaacgatttatccaatttggat
ttctatagcgaaatgtatccgggaactgaatccttagatgcttattgcacaactgacgaa
aacaccaagccttacattttatgcgaatacagtcatgccatgggtaattccaacggcgat
gcggaggactattggcaaacttttgaaaaatatgataaatcctgtggcggttttgtttgg
gaatggtgtgatcacgctccgtatctgcccgacggttcggggcggatgggatacggcggc
gatttcggcgatacccctaacgacggcaatttctgtatggacggtttggtttcgcccact
cgtattccgcacagcaatctgtttgaactaaaaaacgttaaccgaccgattcgcgcccgt
cttgtaggaaatcggattgaagtgaaaaattattgggatttcacccatttagacgaaact
gttacgatttgttatgccgtaaaagaaaacggcgaaatcatagaacagggtgaatgtaaa
gtaaaatgtgcccctaaacagaccgcacttttgccgctgacattgccggattatcacgga
aaattcacgaccttggatttggaatacctcgctgcgacacaatccgcactgttagaaccg
aaccattgctacggattcgagcaacttgtcatttacgataaagatttggtttcgccccaa
aaacctgaaaaaccgaccgcacttttcccttttgcggtggtcgaatccgctcgtagatta
actgtaaaaaatggagattatcaatatatctttgataaagattgcggtatattcaccgaa
attttgcggaaagaaaaagcattaatcgaacagcctttacattttaatatttggcgtgcg
ccgacggataacgaccgtttaatacgcgaattgtggcaaaacgccggttatcatcaaact
tacagccgcgcttattccgtcacttggcaacaaacggaaagtgcggtcgttattcaagcg
attttagctatcgtcgctaccgctaaaaaccggattttaactttgcaggtcaattatact
ttatatcaaaacggacaactgaccattgaagctcatggcgaacgccctgctcatcttccg
tatttaccgcgtttcggtttacgtttctttctgccgaaaacctgtgagcaggcacaatat
ttcggttacggcgagcgtgaaagttattcggataaacatcacctggctcgcctgggtaat
tatgcggtgaatgcggcgcaaaatcacgtccgttatcttaaaccgcaggaaaacggcagc
catttaggttgtcattatgttcgcttaggccattgtttggtttactctcctcttccgttc
agctttaatctttcaccttacacacaggaagaattaacagcaaaaaaccatgactatgag
ttggaggaatgtgattcaaccgtactttgtatagattacaaaatgagcggcatcggttcc
aattcctgcggaccggcattaaaaccgcaataccgattgcaggaaacaaaatttgactgt
cgtttcgatattcactttgaataa

DBGET integrated database retrieval system