KEGG   Actinobacillus succinogenes: Asuc_1478Help
Entry
Asuc_1478         CDS       T00558                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Asuc_1478
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asuc_1478
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Asuc_1478
Enzymes [BR:asu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Asuc_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1640873..1642069
Genome map
AA seq 398 aa AA seqDB search
MSDTILNPYFGEFGGMYVPEILVPVLQQLEKAFVEARNDPDFQQEFQDLLKNYAGRPTAL
TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGSKDVERQSPNVFRMRLMGTEVVPVEKGSCSLKDACCEAMRDWSA
NYENTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEKEGCLPDAVIAAVGGGSNAIG
MFTDFIDETNVRLIGVEPAGKGIETGEHGAPLKHGKTGIYFGMKSPIMQTEDGQIEESYS
ISAGLDFPSVGPQHAYLNSIGRAEYPSITDDEALAAFKELAKHEGIIPALESSHALAQAL
KMIKSNPEKEQLLVVNLSGRGDKDIFTVDKILRAKGEL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacactattttaaatccttattttggtgaattcgggggcatgtatgtgccggaa
attttagttcctgtattacaacaattagaaaaagcattcgtggaagcccgaaacgatccg
gattttcaacaagaatttcaagatttacttaaaaattatgctggtcgccccacagcgttg
acactctgtcgtaacctcactaaaggcacgaaaactaaactgtatctcaaacgagaagac
ttactgcacggcggcgctcataaaacaaatcaggtacttgggcaaattttacttgccaaa
cgcatgggaaaaacacgcattattgcggaaaccggtgcaggtcagcacggtgttgctaca
gcgctcgcctgcgccatgttggatatgccttgtcgcgtatacatgggttcaaaagatgtg
gaacgtcaatcaccgaatgtgtttcgtatgcgtttaatgggaaccgaagtggttcccgta
gaaaaaggttcctgttcgttaaaagatgcctgctgtgaagctatgcgagattggtccgcc
aattacgaaaacacccattatttactgggaacggcggcaggtccgcatccttttcctacc
attgtacgcgaattccaaaaaatgatcggagaagaaactaaacgtcagattcttgaaaaa
gaaggatgcctgcctgatgctgtaattgccgcagtaggcggcggttcgaatgccatcggc
atgtttaccgatttcattgatgaaactaatgtacggttaatcggcgtagaaccggcagga
aaaggtattgaaaccggcgaacacggtgcgccgctgaaacatggtaaaaccggtatttat
ttcggtatgaaatccccgattatgcagaccgaggacggacaaattgaagaatcttacagt
atttccgcagggcttgacttcccttccgtcgggcctcaacatgcctatctgaattccatc
gggcgggccgaatacccaagcattaccgatgacgaagcccttgccgcattcaaggaatta
gccaaacacgaaggcattattccggcattggaaagttcccatgccttggcgcaagcactg
aaaatgataaaatcaaatcccgagaaagaacaactgttggtggtgaatttatccggtcgc
ggcgataaagatatttttaccgtcgataaaattttacgcgcaaaaggagaactgtaa

DBGET integrated database retrieval system