KEGG   Actinobacillus succinogenes: Asuc_1566Help
Entry
Asuc_1566         CDS       T00558                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
asu  Actinobacillus succinogenes
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asuc_1566
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Asuc_1566
  Amino acid metabolism
   00310 Lysine degradation
    Asuc_1566
Enzymes [BR:asu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Asuc_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1724715..1725893)
Genome map
AA seq 392 aa AA seqDB search
MSHFDIITPDLPESVADATVVKWHKAVGDDIKRDDILVEVETDKVVLEVPALDSGVLESI
DQPEGATVVSKQLLGRVAKGETVVAPVSAQPLQTESRPAPDHHDSLGPSVRRLVGEHDLN
PQDISGSGKHGRITREDVAQALADKEAQSAQTAVKNSAEFRDEQRVPMTRLRKRIAERLL
EVKNTTAMLTTFNEVDMQPIMQLRKKYGEKFEKQHDVRLGFMSFYVKAVVEALKRYPVIN
ATIDGDDILYHNYFDISIAVSTPRGLVTPVLRDCDKMSMADIEKQIKVLAEKGRDGKLTV
EDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHTIKDRPVAVDGQVVIRPMMYLALS
YDHRLIDGKDSVRFLVTIKDLLEDPTRLLLEI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagccattttgatattatcacgcccgatttacccgagtccgttgccgatgcgacggta
gtgaaatggcataaagcggtaggcgacgacattaaacgcgatgacattctcgtggaagtg
gaaacggataaagtggtgttggaagtgccggcgttggacagcggcgtactggaaagcatt
gaccagccggaaggtgcgacggttgtcagcaaacaactattagggcgtgtagcaaaaggc
gaaaccgtggtagcaccggtttctgcccaaccgttacaaaccgaatcccgtccggcaccg
gatcatcatgattcgctcggaccttccgtgcgccgtttggtgggcgaacacgatttaaat
ccgcaggatatttccggttccggcaaacacggtcgtatcacgcgtgaagacgtagcgcag
gctttggcggataaagaagcgcaatcagcccaaactgcggtcaaaaactcagcggaattt
cgcgatgagcagcgcgtgccgatgacgcgtctgcgtaaacgcatcgccgaacggttattg
gaagtgaaaaataccacggcaatgctgactacctttaatgaggtggatatgcagccgatt
atgcagttgcgcaaaaagtacggtgaaaaatttgaaaaacagcatgatgtgcgcctcgga
tttatgtctttctacgtgaaagccgtggtagaagccttgaaacgttatccggttatcaat
gctaccatcgacggcgacgatattctgtatcacaattatttcgatatcagtatcgccgtt
tccaccccgcgcggcttggtgacgccggtgttgcgcgattgcgataaaatgagtatggcg
gatatagagaaacaaatcaaagtgttggcggaaaaaggtcgcgacggcaaactcacggtg
gaagacttaaccggcggcaatttcactattaccaacggcggggtattcggttcgttaatg
tccaccccgattatcaatccgccgcaaagcgctattttgggcatgcacactattaaagac
cgtccggttgcagtagacggccaagtagtgattcgcccgatgatgtatttggcattatct
tatgatcaccgcttaatcgacggcaaagacagcgttcgatttctggtcaccattaaagat
ttgctggaggatccgaccagactgttattggaaatttaa

DBGET integrated database retrieval system