KEGG   Actinobacillus succinogenes: Asuc_1575Help
Entry
Asuc_1575         CDS       T00558                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asuc_1575
   01230 Biosynthesis of amino acids
    Asuc_1575
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_1575
   00051 Fructose and mannose metabolism
    Asuc_1575
   00562 Inositol phosphate metabolism
    Asuc_1575
Enzymes [BR:asu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Asuc_1575
Exosome [BR:asu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Asuc_1575
  Exosomal proteins of bladder cancer cells
   Asuc_1575
  Exosomal proteins of melanoma cells
   Asuc_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1738111..1739184)
Genome map
AA seq 357 aa AA seqDB search
MTAKKIYFGTNLKMYKGNAEVVQYLSELSDFATTFKSEYDIQLFVIPSYTTLKDAVELVK
SKTGRPKIKIGAQNMNPNDNGQFTGEISPLMLKELGIELVMIGHSERRHVMKETDQEENE
KVLASLKHNFITLLCIGETLEQKNYNISDEVLRTQLKIGLQGVTAEQLSKLWIAYEPVWA
IGTGGIPASAEYADEKHAVIKQCLFELFAEESKKIPVLYGGSVNPENANSLITKPYIDGL
FIGRSAWNTSNFHALIADVLNTLSGSKIDPIINKFTETAIQLVDKLGGKDNISALTHCAT
RIRVVLRNDGKMDKSAIEKIDCVKGLFSITNQYQIILGAGIVNQVHEEMVKLLARSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaagaaaatttatttcggtaccaatctgaaaatgtataaggggaatgccgag
gtcgtgcaatatctctccgaattatctgattttgccactacctttaaatcggaatatgac
attcaattgtttgtaattccgtcttataccacattaaaagatgccgtggaattagtgaaa
tcaaagacgggtcggcctaaaattaaaattggcgcccagaatatgaatccgaatgacaac
gggcagtttaccggtgagatttcaccgttaatgcttaaagaattgggaatcgaactggtg
atgatcgggcattctgaacgtcgtcatgtgatgaaggaaaccgatcaggaagaaaatgag
aaagtgcttgcgtctttgaagcataatttcattacgctattatgtatcggtgaaacgctg
gagcaaaaaaattacaacatctccgatgaagtattgcgaactcagctaaaaatcggatta
cagggtgttaccgccgaacaattatctaagctgtggattgcttatgagccggtgtgggcg
attggtacgggaggaattccggcaagcgccgaatacgccgatgaaaaacatgccgttatt
aaacaatgtctgtttgaactttttgctgaagaaagtaaaaaaataccagtgctatatggc
ggtagtgttaatcctgaaaatgctaatagcttaattaccaaaccgtatattgatggtcta
tttatcggccgtagtgcatggaatacgtcaaattttcatgcattaattgctgatgtattg
aatacgctttctggcagtaaaattgacccgataatcaataaatttacggaaacagcgata
caactcgttgataaattgggggggaaggataatattagtgctttaacccactgtgctact
cgtattcgcgtagtgttaagaaatgatggaaaaatggataaatcagctattgaaaaaatt
gattgtgttaaagggttattttctattaccaatcaatatcaaattattttaggtgcagga
atagtaaatcaggttcatgaggaaatggtaaaattactggctagatcattataa

DBGET integrated database retrieval system