KEGG   Actinobacillus succinogenes: Asuc_1601Help
Entry
Asuc_1601         CDS       T00558                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asuc_1601
   01230 Biosynthesis of amino acids
    Asuc_1601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_1601
   00051 Fructose and mannose metabolism
    Asuc_1601
   00562 Inositol phosphate metabolism
    Asuc_1601
Enzymes [BR:asu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Asuc_1601
Exosome [BR:asu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Asuc_1601
  Exosomal proteins of bladder cancer cells
   Asuc_1601
  Exosomal proteins of melanoma cells
   Asuc_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1763603..1764388
Genome map
AA seq 261 aa AA seqDB search
MTKKIYFGTNLKMYKGNAEAVDYLTKLSELADTLPADKNLELFVIPSFTTLSDAIAAVRS
IPSKHPIMIGAQNMNPNDSGQFTGDISPLMLKELGVQLVMIGHSERRHVFRETDQEENAK
VLAALKHQFVTLLCVGETLEQKNYGISDEILRTQLKIGLHGVTPDQLSLLRVAYEPVWAI
GTAGIPASAGYADEKQAVIKQCLIELFGEEGDKIPVFYGGSVNPENAPELFVQPHIDGLF
IGRSAWEVDKFHALMSGLLTK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaaaatctatttcgggactaatctgaaaatgtacaaaggtaatgcggaagcg
gtggattatctaaccaaactgtccgaattagcggatacattgccggcggataaaaatctg
gaattatttgtcatcccttcatttactaccttaagcgacgctatcgccgccgtacgcagc
ataccttccaaacatccgattatgatcggtgcgcaaaatatgaatccgaacgattcgggg
caatttaccggcgatatttcgcccctcatgctgaaagaactgggcgtacaattagtaatg
atcggacattccgaacgacgtcacgtattccgtgaaacggatcaggaagaaaatgctaaa
gtattggcggctcttaaacatcaatttgtcactttactttgtgtcggtgaaaccctggaa
caaaaaaactacggtatttccgacgaaatattaagaacccaactaaaaatcggtctacac
ggcgtcacaccggatcaattatcgttgctgcgtgtcgcttatgagccggtttgggcaatc
ggcaccgccggtatccccgcttccgccggttatgccgatgaaaaacaagcggtaatcaaa
caatgtctgatcgaattattcggtgaagaaggcgacaagatcccggttttctacggtggc
agcgtgaatccggaaaatgcaccggaattattcgtccaaccgcatatcgacggattattc
atcggacgcagcgcctgggaagtggataaattccatgcgctaatgtccggtttattgaca
aaataa

DBGET integrated database retrieval system