KEGG   Actinobacillus succinogenes: Asuc_1604Help
Entry
Asuc_1604         CDS       T00558                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Asuc_1604 (glpK)
Enzymes [BR:asu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Asuc_1604 (glpK)
Exosome [BR:asu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Asuc_1604 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1768077..1769585
Genome map
AA seq 502 aa AA seqDB search
MDKKYIIALDQGTTSSRAVLLDHDANIVEIAQREFTQIYPQAGWVEHNPMEIWATQSSTL
NEVVAKAGITSDQIAAIGITNQRETTIVWEKETGTPVYNAIVWQCRRTSDITDKLKAEGY
EDYIRQTTGLVVDPYFSGTKVKWILDNVEGAREKAERGELLFGTVDTWLVWKLTQGRVHV
TDYTNASRTMLFNIHTKQWDDKMLEILDIPRSMLPEVKNSSEIYGQTNIGGKGGVRIPVA
GIAGDQQAALYGHLCVTAGQAKNTYGTGCFMLLHTGNKAITSKNGLLTTIACNAKGEPEY
ALEGSVFIAGASIQWLRDELKIVHDSYDSEYFATKVPSTNGVYVVPAFTGLGAPYWDPYA
RGAILGLSRGANRNHIVRATLESIAYQTRDVLEAMQSDSGEKLKYLRVDGGATANNFLMQ
FQADILDVNVERPVVKEVTALGAAYLAGLAVGFWKDLNELQDKARVERTFTPDNDNEKRE
RRYKGWKKAVRRALEWAKEDAE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaatacattattgcattagaccaaggaacaaccagctcccgtgccgtttta
ctcgatcacgatgcaaacattgtggagatagcccaacgggaattcacacaaatttatccg
caagccggttgggttgaacataatccgatggaaatttgggcgacgcaaagttcaacctta
aacgaagtcgttgcaaaagcaggtattacttccgatcaaattgcggctatcggtattact
aatcaacgggaaaccactattgtgtgggaaaaagaaaccggtacgcctgtttacaatgct
atcgtatggcaatgtcgccgtacttccgatattacggataaattaaaagcggagggttat
gaagattacatccgccaaaccacaggtttagtggttgatccgtatttctcaggtactaag
gttaaatggattttggataatgtggaaggcgcgcgtgaaaaagcggaacgcggcgaacta
ttattcggtaccgtggatacatggctggtatggaagctcacgcagggacgcgtacacgtg
accgactataccaatgcttcccgtaccatgttattcaacattcataccaaacaatgggat
gacaaaatgttggaaattttagatattcctcgttcaatgttgccggaagtgaaaaattca
tctgaaatttacggccaaaccaacatcggtggtaaaggcggggtacgtattcctgtagcc
ggtatcgcaggcgaccaacaagcggcgctttacggacatttatgcgtcaccgccggtcag
gcgaaaaatacttatggtacgggttgctttatgttactccacaccggtaacaaagcgatt
acatctaaaaacggattgttgaccaccatcgcctgtaacgctaaaggcgaaccggaatat
gcgctcgaaggttccgtatttatcgccggtgcgtcaattcaatggttacgtgacgaactc
aaaatcgttcacgacagttacgacagtgaatattttgccaccaaagtaccaagcactaac
ggcgtttatgtcgttcccgccttcaccggtttaggtgcgccatattgggatccttatgcc
cgaggagcgatcttagggttatcccgcggagccaaccgcaaccacatcgtacgtgccact
ttggaatctatcgcataccaaacccgcgacgtattagaagcgatgcaatcagattccggt
gaaaaattaaaatatctccgtgtagacggcggtgcaacggctaacaacttcttaatgcaa
tttcaagcggatattttggatgtaaatgtagaacgtcctgtcgtaaaagaagtaaccgca
ttaggcgcagcttatcttgccggtcttgccgtaggtttctggaaagacttaaatgaatta
caggataaagcacgcgtagaacggactttcacgccggataacgacaatgaaaaacgcgaa
cgccgttataaaggttggaaaaaagcggttcgccgcgcgcttgaatgggcgaaggaagac
gctgaataa

DBGET integrated database retrieval system