KEGG   Actinobacillus succinogenes: Asuc_1732Help
Entry
Asuc_1732         CDS       T00558                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
asu  Actinobacillus succinogenes
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:asu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1903717..1904208
Genome map
AA seq 163 aa AA seqDB search
MATAFIALGSNLNQPVKQLDAAVKAIASLPETVIVKTSSYYGSKPMGPQDQPDYVNAVLK
IQTELSPLTLLDKLQRIENQQGRVRLRRWGERTLDLDILLYDNVKIQSERLTIPHYDMQN
REFVVVPLAEIALERILPDGKTVAELKRNFTHHQLTVISPSQP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgcttttattgctttaggcagcaatctgaatcagccggtgaagcagttggat
gcggcggtcaaggccatcgcttctttaccggaaaccgttattgtaaaaaccagcagttac
tacggcagtaaacccatgggaccgcaggatcagccggattatgtcaatgcggtattaaaa
attcaaaccgagttgtcgccgctgacattattggacaaattacagcgtatcgaaaaccaa
cagggacgggtacgtctacgccgttggggcgaacgtaccttggatttggatattttgcta
tacgataacgtaaaaatacaaagcgaacgactgacgattccccattacgatatgcaaaat
cgcgaatttgtcgtggttccgctggctgaaatcgccttggaacggattctgcccgacgga
aaaacggtggctgaattaaaacgcaattttacgcatcatcaactgactgttatttcgccg
tctcaaccataa

DBGET integrated database retrieval system