KEGG   Actinobacillus succinogenes: Asuc_1901Help
Entry
Asuc_1901         CDS       T00558                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00010  Glycolysis / Gluconeogenesis
asu00052  Galactose metabolism
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01130  Biosynthesis of antibiotics
Module
asu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asuc_1901
   00052 Galactose metabolism
    Asuc_1901
Enzymes [BR:asu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Asuc_1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABR75250
UniProt: A6VQK3
Position
2090752..2091783
Genome map
AA seq 343 aa AA seqDB search
MLEKTTALAPDNAPFQIITLKNAKGMTVQIMDWGATWISCKVPVHGQLREVLLGCKAEDY
PKQTAYLGASIGRYANRIADSRFQVNGRTFVLTANQGKHQLHGGSGFDKRRWTVEKCGQN
FVRFSLLSKDGDQGFPGNVQVTAHYELDDDNGLNVSYEAKCDQDTPLNLTNHAYFNLQNA
GEGCDVRTHILQLNAIQFLPVDSEGIPNAPLKNVGETSFDFRQPKSIKQDFLQEEQLATK
GYDHAFLLNDSATKTAAILTAPDGSLQLKISTSQAALQVYTGNYLTGVPTRSGGIYQDYQ
GIALETQALPDTPNHPEWQRYGGMLKAGEHYRQHTRFQFIADE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaaactaccgcacttgcaccggataacgcgccttttcaaattattaccctt
aaaaatgccaagggtatgacggttcaaatcatggactggggcgccacgtggatttcctgc
aaagtgccggttcacggacaactacgggaagtgttgctgggctgcaaagcggaagattat
ccgaaacaaaccgcttacttgggtgccagtatcgggcgttacgccaaccgcatcgccgat
agtcggttccaagtaaacggacggacgttcgttttgacggcaaatcagggaaagcatcag
ttgcacggcggttcgggattcgataaacgccgctggacggtcgaaaagtgcgggcaaaat
ttcgtgcgtttttccctgctttcgaaggacggcgaccaaggctttcccggtaatgtgcag
gtaaccgcgcactatgagttggatgacgacaacggattgaatgtcagctacgaagcgaaa
tgcgatcaggatacaccgctcaatctgaccaatcacgcctatttcaatttacaaaatgcc
ggtgaaggctgtgatgtgcgcacgcatattttacagctgaacgcgatacaatttttgccc
gtagacagtgaaggtattcccaatgcgccgttaaaaaatgtcggggaaaccagtttcgat
tttcgccaaccaaaatcaatcaaacaggatttcctgcaggaagaacaactggcaacaaaa
ggatatgatcacgcatttctgctcaatgactccgcaacaaaaactgcggcgattttgacc
gcacctgacggttcgctacagttaaaaatcagtacatcgcaagcggcattgcaagtgtat
accggaaattatctgacaggcgtgccgacccgctcgggcggtatatatcaggattatcag
ggtatcgcgcttgaaacccaggcattgcccgatacgccgaaccatccggaatggcagcgg
tacggcggtatgctaaaagccggcgaacattatcggcaacacaccagattccaatttatt
gctgacgaataa

DBGET integrated database retrieval system