KEGG   Actinobacillus succinogenes: Asuc_1901Help
Entry
Asuc_1901         CDS       T00558                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
asu  Actinobacillus succinogenes
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:asu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:asu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2090752..2091783
Genome map
AA seq 343 aa AA seqDB search
MLEKTTALAPDNAPFQIITLKNAKGMTVQIMDWGATWISCKVPVHGQLREVLLGCKAEDY
PKQTAYLGASIGRYANRIADSRFQVNGRTFVLTANQGKHQLHGGSGFDKRRWTVEKCGQN
FVRFSLLSKDGDQGFPGNVQVTAHYELDDDNGLNVSYEAKCDQDTPLNLTNHAYFNLQNA
GEGCDVRTHILQLNAIQFLPVDSEGIPNAPLKNVGETSFDFRQPKSIKQDFLQEEQLATK
GYDHAFLLNDSATKTAAILTAPDGSLQLKISTSQAALQVYTGNYLTGVPTRSGGIYQDYQ
GIALETQALPDTPNHPEWQRYGGMLKAGEHYRQHTRFQFIADE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaaactaccgcacttgcaccggataacgcgccttttcaaattattaccctt
aaaaatgccaagggtatgacggttcaaatcatggactggggcgccacgtggatttcctgc
aaagtgccggttcacggacaactacgggaagtgttgctgggctgcaaagcggaagattat
ccgaaacaaaccgcttacttgggtgccagtatcgggcgttacgccaaccgcatcgccgat
agtcggttccaagtaaacggacggacgttcgttttgacggcaaatcagggaaagcatcag
ttgcacggcggttcgggattcgataaacgccgctggacggtcgaaaagtgcgggcaaaat
ttcgtgcgtttttccctgctttcgaaggacggcgaccaaggctttcccggtaatgtgcag
gtaaccgcgcactatgagttggatgacgacaacggattgaatgtcagctacgaagcgaaa
tgcgatcaggatacaccgctcaatctgaccaatcacgcctatttcaatttacaaaatgcc
ggtgaaggctgtgatgtgcgcacgcatattttacagctgaacgcgatacaatttttgccc
gtagacagtgaaggtattcccaatgcgccgttaaaaaatgtcggggaaaccagtttcgat
tttcgccaaccaaaatcaatcaaacaggatttcctgcaggaagaacaactggcaacaaaa
ggatatgatcacgcatttctgctcaatgactccgcaacaaaaactgcggcgattttgacc
gcacctgacggttcgctacagttaaaaatcagtacatcgcaagcggcattgcaagtgtat
accggaaattatctgacaggcgtgccgacccgctcgggcggtatatatcaggattatcag
ggtatcgcgcttgaaacccaggcattgcccgatacgccgaaccatccggaatggcagcgg
tacggcggtatgctaaaagccggcgaacattatcggcaacacaccagattccaatttatt
gctgacgaataa

DBGET integrated database retrieval system