KEGG   Caldicellulosiruptor bescii: Athe_0031Help
Entry
Athe_0031         CDS       T00857                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00260  Glycine, serine and threonine metabolism
ate00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
ate01130  Biosynthesis of antibiotics
ate01230  Biosynthesis of amino acids
Module
ate_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Athe_0031
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Athe_0031
Enzymes [BR:ate01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Athe_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACM59193
JGI: Athe_0031
UniProt: B9MLI5
Position
39166..40521
Genome map
AA seq 451 aa AA seqDB search
MREEFYKVFLTEDEIPHSWYNITADLKTPLDPPLDPSTKELIDPSKLKAIFPEELIKQEM
TTEAFVPIPEEVLEFYKQYRPTPLIRAKRLEKILDTPAKIFYKYEGATPSGSHKLNTAIP
QAYYNKKEGIKRLATETGAGQWGSALAIACNFFGLDCTVYMVKVSYNQKPYRRILMETFG
AKVIPSPSELTEAGRKILAQDPNSPGSLGIAISEAVEDAATHPDTNYSLGSVLNHVILHQ
TIIGEEAKLQMEKIDEYPDIVIGCCGGGSNFAGISFPFLRDKLRNGRNVRAIAVEPAACP
TLTKGKYTYDFGDVAGLTPLLKMYTVGSQFVPPSIHAGGLRYHGDSPIVSRLYKDGIIEA
RAYKQREVFEAAILFARSEGIIPAPESAHAIKAAIDEAIKAREEGVRKTILISLSGHGNF
DLAAYDDYLNGRLEDIEISDEDIKKSLIKLP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggagttttacaaggtctttttaactgaagatgagatacctcatagctggtat
aacatcactgctgatttaaaaacaccacttgacccgccgcttgacccatcaacaaaagaa
ttgattgacccaagtaaactcaaagcaattttccctgaagagctaataaaacaagagatg
acaacagaggcatttgtaccaattccagaggaagtgttagagttttacaaacagtacaga
ccaactccgcttatcagagcaaaacgactggaaaaaattcttgatactcctgcaaaaata
ttttataagtatgaaggtgcaactccatctggaagccacaagttaaatactgctatacca
caggcatattataacaaaaaagaaggaataaaaaggcttgcaacagagacaggtgcgggc
cagtgggggtctgctttggcaattgcctgcaacttctttggacttgattgcacagtatac
atggtaaaggtaagctacaatcaaaagccttacagaaggatattaatggaaacattcgga
gcaaaggtaataccaagtccaagtgaacttacagaggcaggaagaaaaattcttgcacaa
gatccgaactcacccggaagccttggcattgcaataagcgaggcagtggaagatgccgca
actcatcctgatacaaactattccttaggaagtgttttaaatcatgttattttgcatcaa
actataattggagaagaagcaaaactacaaatggaaaagatagatgaatatcccgacata
gttattggatgctgcggaggtggcagcaactttgcaggaattagctttcctttcttgagg
gataaattaagaaatggaaggaatgtaagagcaatagcagttgaacctgcggcatgtcca
actttaacaaaaggtaagtatacatatgactttggagatgttgcagggctcacacctctt
cttaaaatgtacacggtaggaagccaattcgttccaccaagtattcatgcaggagggctc
cgatatcacggtgattcgccgattgttagcagactttataaggatggaataattgaagca
agagcatataaacaaagagaagtatttgaagcagctattttattcgcaagatcagaaggc
attattccagcgcctgaatctgctcatgctatcaaagctgcaatagatgaagcaatcaaa
gcacgtgaagaaggtgtcagaaagacaattttaatttccttgagcggacatggtaacttt
gatttagctgcatatgatgattatttaaacggcaggcttgaggatattgagatttctgat
gaagatattaaaaaatcattgatcaaattgccataa

DBGET integrated database retrieval system