KEGG   Caldicellulosiruptor bescii: Athe_0097Help
Entry
Athe_0097         CDS       T00857                                 

Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00511  Other glycan degradation
ate00600  Sphingolipid metabolism
ate01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Athe_0097
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Athe_0097
Enzymes [BR:ate01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Athe_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: ACM59257
JGI: Athe_0097
UniProt: B9MLP9
Position
119197..120537
Genome map
AA seq 446 aa AA seqDB search
MHKTIACYVTAKDQDIPMQQVDNIKESTKIESSIVITIEPSTTFQEVIGFGGALTEAAAV
NILSLLPHQQEEILRGYFDPKEGLGYKLCRIHMNSCDFCVDSYSCDDVEGDIELKHFNIE
RDKKMVIPLLKRIKEYCKDLKILVSPWSPPAWMKTNGDMCHGGKLKDEYKKTWARFFCKF
IKAYKEEGIEIWAVTVQNEPMATQVWESCIYTAEEERDFVKYYLGPTLAEEGLGDVKILI
WDHNKDIIYDRVKTILSDKEAAKFVWGVAFHWYGGDHFDQLKKIKEEFPDVNLVFTEGCQ
EGGVKLGSWELGERYAHEIIGDFNNYTIGFMDWNIVLDTVGGPNHVGNFCDAPIIVDKDQ
KKIYYQNACYYIGHFSKFIRPGAKVVKSSCSSSKLEVLAAKSQDDTLAVVVFNKNPEEIE
FSIVIGDKIFSGKSPARSILTIVLEK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacaattgcatgttacgtaacagcaaaagatcaagacattccgatgcagcaa
gtagacaatataaaagaaagcacaaaaatagaaagtagtattgttataacaattgagcca
tccactacatttcaagaggtaataggttttggtggggcactgactgaagctgctgcggta
aatatactgtcgcttttgccacaccagcaagaagagattttaagagggtactttgaccca
aaagaggggcttggctataagctttgtagaatccacatgaacagctgtgatttttgtgtt
gatagctacagctgtgatgatgttgaaggtgacatagagctaaaacactttaacattgaa
cgagacaaaaagatggtaattcctcttttaaaaaggataaaggagtattgcaaagaccta
aaaattcttgtttcgccatggagtccgcctgcatggatgaagacaaacggtgatatgtgc
catggtggaaagctaaaggatgagtataaaaaaacatgggcaagatttttctgcaaattc
ataaaagcatataaagaagaaggaattgagatatgggctgtgacagttcaaaatgagcct
atggcaactcaagtgtgggagtcgtgcatatacacagctgaagaagaaagagattttgtg
aagtattatttggggccgactcttgcggaagaaggactgggggatgtaaagatactcatt
tgggatcacaacaaagacatcatatatgacagggtaaaaacaattttgagtgacaaagaa
gctgcaaaatttgtatggggagttgcattccactggtatggaggagaccattttgaccag
ctcaaaaaaataaaagaagaatttcctgatgtcaatttggtgtttaccgaaggttgtcag
gaaggtggagtgaagcttggttcttgggagcttggagaaaggtatgctcatgagataatt
ggtgattttaataactacacaattggatttatggattggaatattgttcttgacacagtt
ggaggccccaatcatgtaggaaacttttgcgacgctccaataatagttgataaagaccag
aaaaagatttactatcaaaatgcatgttattatatagggcatttttctaaattcataagg
ccgggagctaaagtagtcaaaagtagctgtagtagttcaaaacttgaagttttggcagcg
aagagccaggacgatactttagcagtggttgtgtttaataaaaacccagaggaaatagag
tttagtattgtcattggagataaaatattcagcggaaagtctccagcaaggtctatattg
accattgttctggaaaagtaa

DBGET integrated database retrieval system