KEGG   Caldicellulosiruptor bescii: Athe_0097Help
Entry
Athe_0097         CDS       T00857                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ate00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ate00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
119197..120537
Genome map
AA seq 446 aa AA seqDB search
MHKTIACYVTAKDQDIPMQQVDNIKESTKIESSIVITIEPSTTFQEVIGFGGALTEAAAV
NILSLLPHQQEEILRGYFDPKEGLGYKLCRIHMNSCDFCVDSYSCDDVEGDIELKHFNIE
RDKKMVIPLLKRIKEYCKDLKILVSPWSPPAWMKTNGDMCHGGKLKDEYKKTWARFFCKF
IKAYKEEGIEIWAVTVQNEPMATQVWESCIYTAEEERDFVKYYLGPTLAEEGLGDVKILI
WDHNKDIIYDRVKTILSDKEAAKFVWGVAFHWYGGDHFDQLKKIKEEFPDVNLVFTEGCQ
EGGVKLGSWELGERYAHEIIGDFNNYTIGFMDWNIVLDTVGGPNHVGNFCDAPIIVDKDQ
KKIYYQNACYYIGHFSKFIRPGAKVVKSSCSSSKLEVLAAKSQDDTLAVVVFNKNPEEIE
FSIVIGDKIFSGKSPARSILTIVLEK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacaattgcatgttacgtaacagcaaaagatcaagacattccgatgcagcaa
gtagacaatataaaagaaagcacaaaaatagaaagtagtattgttataacaattgagcca
tccactacatttcaagaggtaataggttttggtggggcactgactgaagctgctgcggta
aatatactgtcgcttttgccacaccagcaagaagagattttaagagggtactttgaccca
aaagaggggcttggctataagctttgtagaatccacatgaacagctgtgatttttgtgtt
gatagctacagctgtgatgatgttgaaggtgacatagagctaaaacactttaacattgaa
cgagacaaaaagatggtaattcctcttttaaaaaggataaaggagtattgcaaagaccta
aaaattcttgtttcgccatggagtccgcctgcatggatgaagacaaacggtgatatgtgc
catggtggaaagctaaaggatgagtataaaaaaacatgggcaagatttttctgcaaattc
ataaaagcatataaagaagaaggaattgagatatgggctgtgacagttcaaaatgagcct
atggcaactcaagtgtgggagtcgtgcatatacacagctgaagaagaaagagattttgtg
aagtattatttggggccgactcttgcggaagaaggactgggggatgtaaagatactcatt
tgggatcacaacaaagacatcatatatgacagggtaaaaacaattttgagtgacaaagaa
gctgcaaaatttgtatggggagttgcattccactggtatggaggagaccattttgaccag
ctcaaaaaaataaaagaagaatttcctgatgtcaatttggtgtttaccgaaggttgtcag
gaaggtggagtgaagcttggttcttgggagcttggagaaaggtatgctcatgagataatt
ggtgattttaataactacacaattggatttatggattggaatattgttcttgacacagtt
ggaggccccaatcatgtaggaaacttttgcgacgctccaataatagttgataaagaccag
aaaaagatttactatcaaaatgcatgttattatatagggcatttttctaaattcataagg
ccgggagctaaagtagtcaaaagtagctgtagtagttcaaaacttgaagttttggcagcg
aagagccaggacgatactttagcagtggttgtgtttaataaaaacccagaggaaatagag
tttagtattgtcattggagataaaatattcagcggaaagtctccagcaaggtctatattg
accattgttctggaaaagtaa

DBGET integrated database retrieval system