KEGG   Caldicellulosiruptor bescii: Athe_0097Help
Entry
Athe_0097         CDS       T00857                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Athe_0097
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Athe_0097
Enzymes [BR:ate01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Athe_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
119197..120537
Genome map
AA seq 446 aa AA seqDB search
MHKTIACYVTAKDQDIPMQQVDNIKESTKIESSIVITIEPSTTFQEVIGFGGALTEAAAV
NILSLLPHQQEEILRGYFDPKEGLGYKLCRIHMNSCDFCVDSYSCDDVEGDIELKHFNIE
RDKKMVIPLLKRIKEYCKDLKILVSPWSPPAWMKTNGDMCHGGKLKDEYKKTWARFFCKF
IKAYKEEGIEIWAVTVQNEPMATQVWESCIYTAEEERDFVKYYLGPTLAEEGLGDVKILI
WDHNKDIIYDRVKTILSDKEAAKFVWGVAFHWYGGDHFDQLKKIKEEFPDVNLVFTEGCQ
EGGVKLGSWELGERYAHEIIGDFNNYTIGFMDWNIVLDTVGGPNHVGNFCDAPIIVDKDQ
KKIYYQNACYYIGHFSKFIRPGAKVVKSSCSSSKLEVLAAKSQDDTLAVVVFNKNPEEIE
FSIVIGDKIFSGKSPARSILTIVLEK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacaattgcatgttacgtaacagcaaaagatcaagacattccgatgcagcaa
gtagacaatataaaagaaagcacaaaaatagaaagtagtattgttataacaattgagcca
tccactacatttcaagaggtaataggttttggtggggcactgactgaagctgctgcggta
aatatactgtcgcttttgccacaccagcaagaagagattttaagagggtactttgaccca
aaagaggggcttggctataagctttgtagaatccacatgaacagctgtgatttttgtgtt
gatagctacagctgtgatgatgttgaaggtgacatagagctaaaacactttaacattgaa
cgagacaaaaagatggtaattcctcttttaaaaaggataaaggagtattgcaaagaccta
aaaattcttgtttcgccatggagtccgcctgcatggatgaagacaaacggtgatatgtgc
catggtggaaagctaaaggatgagtataaaaaaacatgggcaagatttttctgcaaattc
ataaaagcatataaagaagaaggaattgagatatgggctgtgacagttcaaaatgagcct
atggcaactcaagtgtgggagtcgtgcatatacacagctgaagaagaaagagattttgtg
aagtattatttggggccgactcttgcggaagaaggactgggggatgtaaagatactcatt
tgggatcacaacaaagacatcatatatgacagggtaaaaacaattttgagtgacaaagaa
gctgcaaaatttgtatggggagttgcattccactggtatggaggagaccattttgaccag
ctcaaaaaaataaaagaagaatttcctgatgtcaatttggtgtttaccgaaggttgtcag
gaaggtggagtgaagcttggttcttgggagcttggagaaaggtatgctcatgagataatt
ggtgattttaataactacacaattggatttatggattggaatattgttcttgacacagtt
ggaggccccaatcatgtaggaaacttttgcgacgctccaataatagttgataaagaccag
aaaaagatttactatcaaaatgcatgttattatatagggcatttttctaaattcataagg
ccgggagctaaagtagtcaaaagtagctgtagtagttcaaaacttgaagttttggcagcg
aagagccaggacgatactttagcagtggttgtgtttaataaaaacccagaggaaatagag
tttagtattgtcattggagataaaatattcagcggaaagtctccagcaaggtctatattg
accattgttctggaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system