KEGG   Caldicellulosiruptor bescii: Athe_0552Help
Entry
Athe_0552         CDS       T00857                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Athe_0552
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Athe_0552
   00052 Galactose metabolism
    Athe_0552
   00500 Starch and sucrose metabolism
    Athe_0552
   00520 Amino sugar and nucleotide sugar metabolism
    Athe_0552
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Athe_0552
   00524 Butirosin and neomycin biosynthesis
    Athe_0552
Enzymes [BR:ate01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Athe_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
621716..622666
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEEGKIIKKGSVPTGAHRHYTEIMKDMAELSLNLVKECGLTL
DDIHSVGIGSPGAPDNEKGMILYSNNIAFLNVPMREEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTRISVTITLGTGIGGGIIIDGKIYTGSHHAGAELGHMVICVDGEQCTCGRKGC
WEAYASATALIRMTREAAARNINGTIMKLVNGDISKIDAKTAFDAKRMGDSTGTAIVDRY
VKYLAEGLANICNIFEPEVICIGGGVSKEGEYLLEPVRRLVYEKFYCKQVPMPKIIPAVL
GNDAGIIGAALLAKQL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacataggaattgacttgggaggaacaaacattgcagcaggaattgtggatgaa
gaagggaagattataaaaaaaggttctgtgccaacaggagcgcacagacattatacagag
attatgaaggatatggcagagctttctttaaatcttgtaaaggaatgtggacttacactt
gatgatattcattctgttggaattggaagtccaggtgcacctgacaatgaaaagggcatg
attctttacagcaacaatattgcgtttttgaatgtccctatgagagaagagatacaaaaa
tacattccaaagcctgttaacatagaaaacgatgcaaactgtgcagcatatggcgagtat
atagcaggcggtgcaaaaggcacaaggatttcggtaacaataactcttggcacgggaatt
ggtggtggaattataattgatggtaagatttacacaggttcgcaccatgcaggtgctgag
cttgggcatatggtgatttgtgttgacggtgagcagtgcacatgtggccgaaaagggtgc
tgggaagcgtatgcgtctgcaacagctcttattcgtatgacaagagaggctgcagcaaga
aatatcaatggtactatcatgaaacttgtaaatggcgatatttcaaagattgatgcaaaa
acagcttttgacgcaaagcgaatgggagacagcactggtacagcaattgttgacaggtat
gtaaaataccttgctgaaggccttgcaaacatctgcaatatatttgaacccgaagttata
tgtattggcggtggagttagcaaagaaggagagtatcttttagagcctgtgagaaggctt
gtatatgaaaaattctactgcaaacaggttccaatgcccaaaatcattcctgccgttttg
ggcaatgatgctggtataattggggctgcgcttttagcaaagcagctgtga

DBGET integrated database retrieval system