KEGG   Caldicellulosiruptor bescii: Athe_0594Help
Entry
Athe_0594         CDS       T00857                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Athe_0594
Enzymes [BR:ate01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Athe_0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
668619..670886
Genome map
AA seq 755 aa AA seqDB search
MRKIILKFCALMMVVILIVSILQILPVFAQSILYEKEKYPHLLGNQVVKKPSVAGRLQII
EKDGKKYLADQKGEIIQLRGMSTHGLQWYGDIINKNAFKALSKDWECNVIRLAMYVGEGG
YASNPSIKEKVIEGIKLAIENDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIATSFPNDY
HIIYELCNEPNPNEPGVENSLDGWKKVKAYAQPIIKMLRSLGNQNIIIVGSPNWSQRPDF
AIQDPINDKNVMYSVHFYSGTHKVDGYVFENMKNAFENGVPIFVSEWGTSLASGDGGPYL
DEADKWLEYLNSNYISWVNWSLSNKNETSAAFVPYINGMHDATPLDPGDDKVWDIEELSI
SGEYVRARIKGIAYQPIKRDNKIKEGENAPLGEKVLPSTFEDDTRQGWDWDGPSGVKGPI
TIESANGSKALSFNVEYPEKKPQDGWATAARLILKDINVERGNNKYLAFDFYLKPDRASK
GMIQIFLAFSPPSLGYWAQVQDSFNIDLAKLSSAKKIEDRIYKFNVFFDLDKIQDNKVLS
PDTLLRDIIVVIADGNSDFKGKMYIDNVRFTNILFEDINFENSLYDVIDKLYSKGIIKGI
SVFKYLPDKNITRAEFAALCVRALNLKIEKYDGRFSDVKSGNWYSDVVYTAYKNKLFEIK
ENKFFPENILKREEAVALAIEVYKRLTGKIEVNTDDVPIADEKLINPQYRESVKLAIKLG
IVDLYSDGTFEPNKSVSRGEVATILYNLLNLAGKL
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaattattttaaagttttgtgcactcatgatggtagtgattttgattgtttcc
attttacaaatattacctgtatttgcccagagcatactgtatgaaaaggaaaaatatcca
catcttcttggcaatcaggtagttaaaaaaccatcggttgccggcagactgcagattatt
gaaaaggacggaaaaaagtatttagctgaccagaaaggagaaataattcagcttcgtggt
atgagtacacatggacttcagtggtatggtgatattataaacaaaaatgcatttaaagct
ctttcaaaagattgggagtgcaacgttataaggcttgcgatgtatgtgggtgaaggcgga
tatgcttcaaacccaagtattaaagaaaaagttatagaagggattaagcttgctattgag
aatgacatgtatgtaattgttgactggcatgtattaaatcccggtgacccgaacgcagaa
atttataaaggggcaaaagactttttcaaagagatagctacaagttttcccaatgactat
cacataatatatgaactttgcaatgaaccaaatccaaatgaaccgggagtagaaaatagc
ttggatggctggaaaaaagtaaaggcttatgcacagcccatcataaaaatgctcagaagt
ttggggaatcagaacattataattgtaggttcgccaaactggagtcagagacctgacttt
gcaattcaagaccctataaatgataagaatgttatgtattcagttcatttttactctgga
actcacaaagttgatggatatgtttttgaaaacatgaaaaatgcgtttgaaaatggcgtg
ccaattttcgtgagtgaatggggaacaagtttggcaagcggtgatggtggaccgtatctt
gatgaagcagataagtggcttgaatatttaaattcaaactatattagctgggtgaactgg
tcgctgtcaaacaaaaatgagacatcagctgcttttgttccatatataaatggtatgcat
gatgccacaccacttgaccctggtgatgataaggtgtgggacatagaagagcttagtatt
tctggagagtatgtgagggcaaggataaaaggaattgcttatcagccaattaagagagat
aacaaaataaaagaaggagaaaatgcacctttaggcgaaaaagtcttaccatccacgttt
gaagatgacactcgtcagggctgggattgggatggaccatctggtgtgaaaggtcctatt
actatcgaaagtgcgaatggttcaaaagcgctatcttttaatgttgagtatccagagaaa
aaaccacaagatggctgggcaacagctgcaaggcttatacttaaagacataaatgtagaa
aggggaaataataaatatttggcttttgatttttatttgaaaccagatagggcttcaaaa
ggtatgattcagatatttttagctttttcaccaccttccttaggttactgggctcaggta
caagacagttttaatattgaccttgcaaaactgtcaagtgcaaaaaagatagaagacaga
atttataagttcaatgtattttttgacttagacaagatacaagataataaagtactgagt
ccagacacactcttgagagatataatagtagtcatagcagatggcaatagcgattttaag
gggaaaatgtatatagataatgttagatttaccaatatcctttttgaggatatcaatttt
gaaaatagcctttatgatgttatagacaagctttattctaaaggaatcataaaaggaatt
tcagtatttaagtacttgccagataaaaacattacaagggctgaatttgctgcactttgt
gtcagggcactgaacctgaaaattgaaaaatacgatggtagattttctgatgtgaaaagc
ggcaactggtattcagatgtagtttatacggcgtataaaaacaaattgtttgaaataaaa
gagaataaattctttcctgaaaatattttaaaaagagaagaagcagtagctttggcaatt
gaagtgtataaaagattgactggtaagatagaagttaatacagacgatgttccaattgct
gatgaaaaacttataaatcctcaatacagagaaagcgtgaagttagcaattaagctcggt
attgttgacctgtattcagacggaacatttgaaccaaataagagcgtttcaagaggggag
gtggcaacaattctctataatctcttgaacttagcaggcaagctatga

DBGET integrated database retrieval system