KEGG   Caldicellulosiruptor bescii: Athe_0618Help
Entry
Athe_0618         CDS       T00857                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ate  Caldicellulosiruptor bescii
Brite
Enzymes [BR:ate01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Athe_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
701714..703783
Genome map
AA seq 689 aa AA seqDB search
MSVCLYKRLKRFSVLILVILFLIVTLIGIETTKTSRVIGETKKSFVEYNFENRFIAPFKA
SGKSMSLRIDNTTAAEGTFSLLASGRKQIDDGILLDVTNLIDYANEYKITLYVYHKSSKM
QRFVVSSEIETKSGKENKLLCEKIIIPKSWKKLDANLNLTEQKGIKKVWLKVYVPTSTTN
FYVDLFTLKVADKSHLIKFENFEDKSIAGFISQDKKCKLSISKEKAYQGTYSIKVQQTVK
RQNTTVILPVKGTFEKGKSYSISFYMHQSILKSLNFAVGIRFLESGKNMREIVLGRVTIP
KNKWTEVFASYTPSLDSKIKDFVIFIRPLSDISYYYIDNFTISDDGWYSAVPDLDLPSLR
EKYKNYFKIGVAVPYRALTNPVDVAFIKRHFNSITAENEMKPEALEPIEDNFNFSIADEY
LNFCRKNNIAIRGHTLVWHQQTPNWFFENPQTGKKLTNSEKDKKILLERLKKYIQTVVSR
YKGRIYAWDVVNEAIDENEPDGFRRSDWFNVLGPEYIEKAFIYAHQADPNAQLFYNDYST
ENPVKREYIYKLIKSLREKGIPIHGVGLQCHISVSWPSVEEVEKTIKLFSSIPGIKIHVT
EIDISVAKEYGEDIDEETKRYLLIQQARKLKDLFDVFKKYKNVVTSVSFWGLKDDYSWLQ
GDFPLLFDKDYQPKFAFWSLIDPSVVPEE
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtttgtctttataaaaggttgaaaaggttttcagtattgattttagtaatttta
tttttgattgtaaccttaattggtatagaaactactaaaactagtagagtcattggagaa
acaaaaaagagttttgtggagtataattttgaaaataggtttatagcaccatttaaagcg
tcaggaaaatctatgagtttaaggattgacaatacaacagcagcagaagggaccttttca
cttcttgcaagtggccgaaagcaaatagatgatggaattttgcttgatgtaaccaatctt
atagattatgcaaatgaatataaaattactctatatgtttatcacaagtcaagcaaaatg
cagcgttttgttgtgagtagcgaaattgagacaaaaagcggaaaagaaaacaaactgctg
tgtgaaaaaattattattccaaaaagttggaaaaaacttgatgcaaatttaaatttgact
gagcaaaaagggataaaaaaagtttggctaaaggtatatgtgccaacctcaaccacaaat
ttttacgttgacctttttacactcaaagttgctgacaaatctcatctaataaaatttgaa
aactttgaagataaaagtatagcaggatttatctctcaagataaaaaatgtaaattatcc
atttcaaaagaaaaagcttaccaaggtacatatagcataaaagttcagcaaacagttaaa
agacaaaacacaacagttatcttgcctgtaaaaggaacatttgaaaaggggaaaagttat
tcaatatctttttatatgcatcaatccattctaaagagtttaaattttgcagttggtata
aggtttctggaaagtggaaagaatatgagagagattgtgcttgggagggtaaccattcca
aagaataagtggacagaagtatttgcaagttatacgccctctttggattcaaagataaaa
gactttgtgattttcataagacccctctcagatatttcctattactatatcgacaacttt
acaatttcagatgatggatggtattcagctgtacctgatttagatttaccttctttgaga
gagaaatacaaaaactactttaaaattggtgttgctgtaccatacagggctttgacaaat
ccagttgatgttgctttcataaagagacattttaacagcattacagcagagaatgagatg
aagccagaagcacttgaaccaatagaggacaatttcaacttttcaattgctgatgagtat
cttaatttctgcagaaagaataatatagctattcgtggtcacacacttgtgtggcatcag
caaaccccaaactggttttttgaaaaccctcagacagggaaaaagctgacgaatagtgaa
aaagacaaaaagatacttttagagaggctaaaaaagtatatccagacagttgtttcaaga
tacaaggggagaatatatgcatgggatgtggtaaatgaagctattgatgagaatgagcca
gatggatttagaagaagtgactggtttaatgtattgggtccagagtatatcgaaaaagcg
ttcatatacgctcatcaggcagaccctaacgctcagcttttttacaatgactacagcaca
gaaaatccagtaaagagagaatatatttacaagctaataaagagtctaagagaaaaagga
atacccattcatggtgttggtcttcagtgtcatatttctgtaagctggccaagcgttgaa
gaggtagaaaaaactataaaactttttagcagcattcctggtattaagatacatgtcaca
gaaattgatataagtgtggcaaaagaatatggtgaagacatagatgaagaaacaaaaaga
tatcttttgattcagcaggcaagaaagttaaaagatctttttgatgtgttcaaaaaatac
aaaaatgtagtaacaagtgtttcgttctggggactcaaagatgactattcatggcttcaa
ggtgattttccacttttgtttgacaaagattatcaaccaaaatttgctttctggagctta
atagacccgtcagttgtgccagaagaataa

DBGET integrated database retrieval system