KEGG   Caldicellulosiruptor bescii: Athe_0655Help
Entry
Athe_0655         CDS       T00857                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Athe_0655
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Athe_0655
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Athe_0655
Enzymes [BR:ate01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Athe_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
737787..739268
Genome map
AA seq 493 aa AA seqDB search
MRYVSTRGNKEVKAKEAIYRGIAEDGGLYTPVFIPHLDLSKIKSIESYANLAKYIFELYL
TDFTNEEIIDCIDKSYSNGKFDTKDVVVLKKLDSSLFALELWHGPTYAFKDVALQVLPHL
LLKSMPSFYKQALILVATSGDTGKAALEGFKDVDRTKIVVFYPSEGVSEVQKRQMTTQEG
RNTFVAGIKGNFDDAQSGVKEIFTSKKCIDEIENLGFFFTSANSINFGRLLPQIVYYIWS
YLVLLKAGDISEGEKINFVVPTGNFGNILAGFIAKLMGVPINKLIVASNINSVVADFVRT
GLYDRRREFYKTISPSMDILVASNLERLLYLITKESERVKKYMMDLKSEGYFKVEEEVLK
EIQESFWGDFSTDDQTRSSIKIIYREYDYLIDPHSAVGFDVYRKYQKQTFDSTKTVVLQT
ANPYKFAKDVLNALFDGEYNNIDPFEAVEILYAKTGVEVPEGIKSLLAKPILHPDVIEKN
KMFDFILEKIRDN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatgtaagtacaagaggtaataaagaggttaaagcaaaagaggctatttacagg
gggatagccgaggatgggggactttacacccctgttttcatacctcatcttgacttaagt
aagataaaaagtatagaatcttacgcaaatcttgcaaaatatatatttgagctctatctt
actgattttacaaatgaagagattattgattgcattgacaagtcatatagtaatggcaag
tttgacacaaaagatgttgttgttttaaaaaagcttgacagtagcctttttgcacttgaa
ctttggcacggtccgacatacgctttcaaagatgttgctttacaggtgctacctcatctt
ttactaaaatcaatgccaagtttttacaaacaggcactcatacttgttgcaacgtcaggc
gatactggcaaggctgccttggaagggtttaaggatgttgatagaacaaagatagttgtg
ttttatccatctgagggtgtgtcagaggttcagaaaagacagatgacaactcaggaaggc
agaaacacttttgttgctgggataaaaggcaattttgacgatgcccaatctggcgtgaaa
gagattttcacaagcaaaaaatgcatagatgaaattgaaaatctggggtttttctttacg
tctgcgaactcaataaattttggtaggcttcttccacagattgtatactatatctggagc
tatctggtgcttttaaaagctggtgatatatctgaaggtgaaaagataaactttgttgtt
ccgacaggcaattttggcaatatattggcaggttttattgctaaacttatgggagttcct
ataaataagttgattgttgcttcaaacataaacagtgtggttgctgattttgtcaggaca
ggcttatatgatagaagaagagagttttacaaaacaatttcaccttcaatggatattctt
gttgcaagtaatttagaaaggttattatatttaataacaaaagaatcagaaagagtaaaa
aaatacatgatggatttaaaaagtgaggggtatttcaaagttgaagaagaagttttaaaa
gagattcaggaaagtttctggggtgatttttccacagatgaccagacaagaagtagtata
aagattatttaccgcgagtatgactatcttattgacccgcattctgctgttgggtttgat
gtttacagaaaataccagaagcagacgtttgatagtacaaaaacggttgtacttcaaact
gcaaatccttacaagtttgcaaaagatgttttgaacgctttgtttgatggtgaatataat
aatattgacccgtttgaagcggtagagattttgtatgcaaagacaggtgttgaggtccca
gaagggattaaaagtcttcttgcaaaaccgattttgcatcctgatgtgatagaaaaaaac
aagatgtttgattttatattagagaaaataagagataattga

DBGET integrated database retrieval system