KEGG   Caldicellulosiruptor bescii: Athe_0773Help
Entry
Athe_0773         CDS       T00857                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Athe_0773
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Athe_0773
Enzymes [BR:ate01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Athe_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
862200..863660
Genome map
AA seq 486 aa AA seqDB search
MKLLDLIENIDVLETNVGDFDKDITDIAYNSKNAKEGCVFVCIKGFKTDGHEYINEAIQN
GACLVVVDEFFDTSKIEGKIDYIKTSNTRKALAVMSANFFGHPSKDFLLIGVTGTNGKTS
TTFMIKSILEAHGQKVGLIGTIKNMIGSREIEAQHTTPESYDLQKLFWQMKSEGVDSVVM
EVSSHSLELFRVYDCDFDVGVFTNLTQDHLDFHGTMENYFAAKLKLFGMSKKRVVNADDM
WGKRIIEMYPDSVTYAKDSDAQVFARNIKLFVNKNQFELWYNGEKEEITLNIPGVFSIYN
SLAASACCISLGIKLDDIKKGLENLKAVPGRFEIVESNQKFTVVIDYAHTPDGLLNLMKT
VNEVTDGRKVLLFGCGGDRDRTKRPIMGEIAGRMADFVIVTSDNPRTEDPLKIIADILEG
IKKTNVEYVVIPDRYEAIKYAIKNARENDFIVLAGKGHETYQILKDRTIPFDEREVVKNI
LKEIRE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattattggatttgattgagaatattgatgttttagaaacaaatgttggagatttt
gataaagatataactgatattgcgtacaattcaaagaatgcaaaagaaggctgtgttttt
gtgtgtataaaaggctttaaaacagatgggcatgaatatataaatgaggcaatccaaaat
ggtgcatgtttggtggttgtagatgagttttttgacacatctaaaattgaagggaagatt
gattatataaagacttcaaatacacgtaaagcccttgctgttatgtctgcaaactttttt
ggtcatccttcaaaggactttttgctaataggtgtaacaggtacaaacggcaaaacttca
acaacatttatgataaaatccatccttgaagctcatgggcaaaaagtggggttgattggt
acaatcaagaatatgataggtagcagagaaattgaagctcagcatacaacgcctgagtct
tatgacctgcaaaaactcttttggcaaatgaaaagtgagggtgttgacagtgttgtgatg
gaagtttcttcgcactctcttgaactttttcgagtatatgactgtgattttgacgttgga
gtttttacaaacctcactcaggaccatttagactttcatggaacaatggaaaattatttt
gctgcaaagttgaaacttttcggtatgagcaaaaagagggttgtaaatgctgatgatatg
tggggaaaaaggattatagaaatgtatcctgacagtgtgacatacgctaaagacagcgat
gcccaagtttttgcacgaaatataaaactttttgttaacaaaaatcaatttgagttgtgg
tacaatggggaaaaagaggagataacacttaacattcctggtgttttttcgatttacaac
agccttgctgcttctgcatgttgtatttcgcttggtataaagcttgatgatataaaaaaa
gggcttgaaaatctaaaagcagtgccaggaaggttcgagattgtagagtcaaaccaaaag
tttactgtggtgattgactatgcacacacaccagatgggttattaaatctcatgaagaca
gtaaatgaagttacagacggcagaaaagtgttactttttggatgtggcggagacagagat
aggacaaaaagaccgattatgggtgagattgccggaagaatggcagattttgtgattgtt
acatctgacaatccacgaacagaagacccactcaagataattgctgatatcttggaaggg
ataaaaaagacaaatgttgagtacgtggtcatacccgacaggtatgaggctattaaatat
gccataaagaatgcaagagaaaacgattttattgttcttgccgggaaaggacatgagact
taccagattttaaaagacagaacaataccatttgatgagagagaggttgtgaagaatatc
ttaaaggagataagagaatga

DBGET integrated database retrieval system