KEGG   Caldicellulosiruptor bescii: Athe_0806Help
Entry
Athe_0806         CDS       T00857                                 

Definition
50S ribosomal protein L7Ae/L30e/S12e/Gadd45
Orthology
K07590  
large subunit ribosomal protein L7A
Organism
ate  Caldicellulosiruptor bescii
Pathway
Ribosome
Class
Genetic Information Processing; Translation; Ribosome [PATH:ate03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
903022..903276
Genome map
AA seq 84 aa AA seqDB search
MSSSDIEALKTSPKTVGARQTAQAIQKGKAKVVFVAKDSDEWVVRDIIDMCKQKGIKLVF
VDSKKELGKICGISVAASSAAIIE
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
ttgtcatcatcagacattgaagctttaaaaacttcaccaaagacagttggtgcgcgtcag
actgcccaagctatccaaaaaggcaaagcgaaggttgtttttgtcgcaaaggacagcgat
gagtgggtagtgagggatataatagatatgtgcaagcaaaaagggataaaacttgtgttt
gtggattccaaaaaagagcttggcaaaatttgtggtataagtgtggcagcatcgtctgcc
gcaataattgaataa

DBGET integrated database retrieval system