KEGG   Caldicellulosiruptor bescii: Athe_0821Help
Entry
Athe_0821         CDS       T00857                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00030  Pentose phosphate pathway
ate01100  Metabolic pathways
ate01120  Microbial metabolism in diverse environments
ate01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Athe_0821
Enzymes [BR:ate01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Athe_0821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: ACM59936
JGI: Athe_0821
UniProt: B9MQI2
Position
916146..917906
Genome map
AA seq 586 aa AA seqDB search
MIGKDFIRVLYIDLTNKKADIQERKDLYKYLGGAGVAAKLLEENMKKGVDPLHESQPLII
SIGPLSTIFPVVTKAVATFISPHTGEYGESHAGGRLAMAIRNAGYDAIVITGKAQKPTYL
VITDKNIEFKDARAMWGLDIEETGRVIREREPGPGKRSIIRIGKAGENLVTYSCVNVDTY
RHFGRLGIGTVFGSKNLKAMMIMGEEDLPIANLKEYFKTYQEIYKKVTQTDAMAKYHELG
TPMNIKVLNSISSLPTKNLLQSTFEHADDISGETFAEKNLVRKVSCVGCPIGCIHIGQFR
REFDKGYEYESISVSYDHELIYALGSLLGIKTTDEVLQIIEEVELAGLDAISTGVVLAWA
TEALKKGLISREDTLADLEFGNTMEYVKAIDNIADRSNEFYYTIGKGLKEAVKKYGGEEF
ALLYGGNEMAGYHTGYAFALGQTVGARHSHLDNAGYSYDQSAKELKDEEIIDYVINEEKE
RAVLTSLCICLFARKVYDRSTILKALNAVGINWTDDDLTRLANDVFFTKLKIKKELGYSL
ENYKFPKRIFETPTMWGKMDEERLNRLLKMYIERVEKEYEDWSRGK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaagactttataagagtgctttatatagaccttacaaacaaaaaagcagac
attcaagaaaggaaggatctttataaatacttaggcggagcaggtgttgctgcaaagctt
ttagaggaaaatatgaaaaaaggtgttgaccctttgcatgaaagccagccgttaatcatt
tcaatcggacctctttcaacaatctttcctgttgtgacaaaagctgtagcaaccttcatt
tcacctcatacaggcgagtatggtgaaagccatgcaggtggaagacttgcaatggctata
agaaatgcgggatatgatgcaatagtaataacaggaaaggctcaaaagccaacatacctt
gtcattacagataagaatattgaatttaaagatgcaagggctatgtggggacttgacata
gaagaaacaggaagagtgataagagaaagagagccaggtccaggaaaaagaagcataatc
agaattggcaaggcaggggaaaaccttgtaacatactcttgtgtcaacgttgatacttac
agacattttggaaggcttgggattggtacggtctttggcagcaagaacctcaaagctatg
atgataatgggagaagaggacttgccaattgccaaccttaaagaatactttaagacttat
caggagatatacaaaaaagttacacagacagatgcaatggctaagtatcacgagcttgga
acacctatgaatatcaaagttctaaatagcataagttctcttccaactaagaatttactt
cagtcaacatttgagcatgcggacgatatctcaggtgagacatttgctgagaaaaacctt
gtcagaaaggtttcgtgtgtaggatgtcctattggatgcatccatataggacagttcaga
cgcgagtttgacaagggatatgagtatgagtccatttctgtctcatatgaccatgaactt
atatacgcacttggaagccttttggggataaagacaacagacgaggtattgcagattata
gaagaggttgaacttgcaggacttgatgctatctcaacaggtgttgtattggcatgggca
acagaagcgctcaaaaaaggacttatctcaagagaagacactcttgctgaccttgagttt
ggcaacaccatggagtatgttaaagcaatcgacaatattgcagatagaagcaacgagttt
tactacacaattggcaaaggtttgaaagaagctgtgaaaaaatatggaggagaagagttt
gcacttttgtatggtggcaatgagatggcaggatatcatacaggctatgcatttgcgctt
ggtcaaacagttggtgcaaggcattctcatttagacaatgcaggttactcttatgaccag
agtgcaaaagaattaaaagatgaggaaataatagattatgtaattaatgaagaaaaagaa
agggcagtgctcacatcactatgcatatgtctgtttgcccgaaaggtgtatgacaggtca
accatcttgaaagcgttaaatgctgttggtataaactggacagacgatgacctcacacga
cttgcgaatgatgtatttttcacaaaactgaaaatcaaaaaagagcttggatattcactt
gaaaattataagtttccaaagagaatatttgaaacaccgacaatgtggggtaagatggat
gaagagaggttaaataggcttttgaaaatgtatatcgagagggtggaaaaggaatatgaa
gattggagtagaggtaaatag

DBGET integrated database retrieval system