KEGG   Caldicellulosiruptor bescii: Athe_0857Help
Entry
Athe_0857         CDS       T00857                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Athe_0857
  Lipid metabolism
   00600 Sphingolipid metabolism
    Athe_0857
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Athe_0857
Enzymes [BR:ate01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Athe_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
954155..956668
Genome map
AA seq 837 aa AA seqDB search
MWRTINTPAILSRCFSEAAQDVLEFQKMQKINLDRSWEYLELGFANVLNLTSSEYEWKKV
DLPHDAVIEKERSEANPSGAGEGYTAGCSLYYKKELILDEEWQGKNLILEFEGIMGIAEV
FVNGRLVAKHFNGYTSFLIDITKHVKFDDKNIIIVRVENTHKPSSRWYAGCGIYRHVWLH
IGGKVYIKPWHLHVQTRAIENETAKLEVRAVVVNSVNEKVQGVIKFDVFSKDEKLILSSE
EKFLIGKNEEKVIAKTLELKPFKYWDIEDPYLYKIQATIICDESIEDSASTLFGIRTISV
DPKEGFKLNGKPLKLKGGCIHHDNGPLGSASYDRAEERKVELLKASGFNAVRLAHNPFAP
AFLDACDRLGMLVIEEFFDVWHAGKVSFDYHLFFDKYWEEDLESTIMRDYNHPSIIMWSI
GNEITWGVGVDVDDDSSYSIYTWCERLAKKVKSLDSSRLITAALCAIPDDYKRLFAIIEE
GNYVIRMLKQEVDVIEDKWGEFSEKFSRFLDVVGYNYKVDRYGFDRYKYPDRVICGTETY
PYTLFKNWKQTIENSNVIGDFVWTAIDYLGEAGLGRVSIEADDLKSFCGSYPWFLANCGD
IDICGEKRPQSYYRDVVWGNRKDPYIVILPPQVYGKKLYFKPWAWEPVERNYTFPGYEGM
KVAIHVYADADEVELFVNGRSLGRKEVGINTQFKMVYDTIYEPGVIEAVAYKDGKEIGRD
KIETTGEPVALKLVPDREVISSSYGDLCYIKIMAVDRKGREVVFADNRIVVEVEGVGELV
ALGSSNPLSTEPFVSRERKLYKGRALAIVKSIGKKGEFKLKAWAEGLDGAQVFVKCI
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggactataaataccccagccatcttgagccgctgcttttctgaagcggctcaa
gatgttcttgagtttcaaaaaatgcagaagataaatttggacaggtcatgggaatatctt
gagcttggttttgcaaatgtattaaacttaacaagttcagaatatgagtggaaaaaggtg
gatctgccacatgatgctgtaattgaaaaagaaagaagtgaggctaatccctcaggtgcc
ggtgaagggtatactgcgggatgcagtttgtattacaaaaaagaattgattttagatgaa
gagtggcaaggcaaaaacttaatacttgagtttgaaggaatcatgggtatagctgaggtt
tttgtaaatggtaggttagttgctaaacacttcaatggatacacaagttttctaattgat
ataacaaagcatgtcaagtttgatgataagaacattattattgtgcgtgtagaaaatact
cataagccaagctcaagatggtacgcaggttgtggcatatacagacacgtgtggctacac
attggtggcaaggtgtatataaaaccatggcatttgcatgttcaaaccagagcaattgaa
aatgaaactgcaaagttagaagtaagagctgttgttgtcaacagtgttaatgaaaaagtt
caaggagtaataaaatttgatgtattttcaaaagatgagaaactaattctcagcagtgaa
gagaagtttttgattggtaaaaatgaagaaaaggtaattgccaaaaccttagaactaaaa
ccatttaaatattgggatatagaagacccatatctttataaaattcaagcaactattatt
tgtgatgagagtattgaagatagtgcttctacattgtttggtattcggacaatttcagtt
gatcccaaggaaggatttaaattaaatggtaagccattaaaattaaaaggtggctgtatt
catcatgacaatggaccacttggaagtgcgagttacgatagggcagaagagagaaaagta
gaacttttaaaagcttctggattcaatgcggtaagacttgcacataatccttttgctcca
gcttttttggatgcatgtgatagattagggatgcttgtgatagaagaattttttgatgta
tggcatgctggcaaggttagctttgactaccatctattttttgacaagtactgggaagaa
gatttggagtccaccataatgagggactataatcatccttcgataataatgtggtcaata
ggaaacgagattacatggggagttggagttgatgttgatgacgatagtagctactcaata
tacacctggtgtgaacgattagcaaaaaaggtaaaaagtttggattcatcaaggctaata
acagcggcactgtgcgcaattccggatgattataaaaggctttttgctataattgaagaa
ggtaactatgtaattagaatgctaaaacaagaagtagatgttattgaagataaatggggc
gagttttcagagaagttttcaagatttctggatgtagttggttataactataaagtagat
agatatggattcgataggtataaatatcctgaccgagtaatctgtggcacagaaacttat
ccatatactctttttaaaaactggaaacaaacaatagaaaattcaaatgttataggtgat
tttgtgtggacggctattgattatttgggcgaagcaggtcttggtagggtaagtattgaa
gcagatgaccttaaatctttctgcgggtcttatccatggtttttagcaaattgtggggat
attgatatttgtggggaaaaacgtcctcaatcgtattatagagatgttgtttggggaaat
agaaaagacccttatattgtaatacttccaccgcaagtttatggcaaaaaactatatttt
aaaccctgggcatgggaaccggtcgaaagaaactacacttttcctggatatgaagggatg
aaggtggctatacatgtctatgcagatgcagatgaggttgagctgtttgtaaatggcaga
agtttgggaagaaaagaagtagggattaatactcagtttaaaatggtttatgacacaatt
tatgaaccaggagtgatagaagctgtagcatacaaagatggtaaagagattggcagagac
aaaatagaaacaacaggtgagcccgtagccttaaaactggtgcctgatagagaagttata
tcctcttcttatggtgatttgtgctatataaaaataatggcagtagatagaaagggaaga
gaggttgtttttgcagataacagaatagttgtagaagttgaaggtgttggcgaacttgtt
gctttaggaagtagcaatcctttgtcaacagaaccatttgttagccgagagagaaagctc
tataaggggcgagcattggcaatagtaaagagcattggcaaaaaaggagaatttaaattg
aaagcttgggcagaaggattggatggtgcacaagtttttgtaaaatgcatttaa

DBGET integrated database retrieval system