KEGG   Caldicellulosiruptor bescii: Athe_0857Help
Entry
Athe_0857         CDS       T00857                                 

Definition
(GenBank) glycoside hydrolase family 2 sugar binding
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00052  Galactose metabolism
ate00511  Other glycan degradation
ate00600  Sphingolipid metabolism
ate01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Athe_0857
  Lipid metabolism
   00600 Sphingolipid metabolism
    Athe_0857
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Athe_0857
Enzymes [BR:ate01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Athe_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2 Glyco_hydro_2_N
Motif
Other DBs
NCBI-ProteinID: ACM59972
JGI: Athe_0857
UniProt: B9MQL8
Position
954155..956668
Genome map
AA seq 837 aa AA seqDB search
MWRTINTPAILSRCFSEAAQDVLEFQKMQKINLDRSWEYLELGFANVLNLTSSEYEWKKV
DLPHDAVIEKERSEANPSGAGEGYTAGCSLYYKKELILDEEWQGKNLILEFEGIMGIAEV
FVNGRLVAKHFNGYTSFLIDITKHVKFDDKNIIIVRVENTHKPSSRWYAGCGIYRHVWLH
IGGKVYIKPWHLHVQTRAIENETAKLEVRAVVVNSVNEKVQGVIKFDVFSKDEKLILSSE
EKFLIGKNEEKVIAKTLELKPFKYWDIEDPYLYKIQATIICDESIEDSASTLFGIRTISV
DPKEGFKLNGKPLKLKGGCIHHDNGPLGSASYDRAEERKVELLKASGFNAVRLAHNPFAP
AFLDACDRLGMLVIEEFFDVWHAGKVSFDYHLFFDKYWEEDLESTIMRDYNHPSIIMWSI
GNEITWGVGVDVDDDSSYSIYTWCERLAKKVKSLDSSRLITAALCAIPDDYKRLFAIIEE
GNYVIRMLKQEVDVIEDKWGEFSEKFSRFLDVVGYNYKVDRYGFDRYKYPDRVICGTETY
PYTLFKNWKQTIENSNVIGDFVWTAIDYLGEAGLGRVSIEADDLKSFCGSYPWFLANCGD
IDICGEKRPQSYYRDVVWGNRKDPYIVILPPQVYGKKLYFKPWAWEPVERNYTFPGYEGM
KVAIHVYADADEVELFVNGRSLGRKEVGINTQFKMVYDTIYEPGVIEAVAYKDGKEIGRD
KIETTGEPVALKLVPDREVISSSYGDLCYIKIMAVDRKGREVVFADNRIVVEVEGVGELV
ALGSSNPLSTEPFVSRERKLYKGRALAIVKSIGKKGEFKLKAWAEGLDGAQVFVKCI
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggactataaataccccagccatcttgagccgctgcttttctgaagcggctcaa
gatgttcttgagtttcaaaaaatgcagaagataaatttggacaggtcatgggaatatctt
gagcttggttttgcaaatgtattaaacttaacaagttcagaatatgagtggaaaaaggtg
gatctgccacatgatgctgtaattgaaaaagaaagaagtgaggctaatccctcaggtgcc
ggtgaagggtatactgcgggatgcagtttgtattacaaaaaagaattgattttagatgaa
gagtggcaaggcaaaaacttaatacttgagtttgaaggaatcatgggtatagctgaggtt
tttgtaaatggtaggttagttgctaaacacttcaatggatacacaagttttctaattgat
ataacaaagcatgtcaagtttgatgataagaacattattattgtgcgtgtagaaaatact
cataagccaagctcaagatggtacgcaggttgtggcatatacagacacgtgtggctacac
attggtggcaaggtgtatataaaaccatggcatttgcatgttcaaaccagagcaattgaa
aatgaaactgcaaagttagaagtaagagctgttgttgtcaacagtgttaatgaaaaagtt
caaggagtaataaaatttgatgtattttcaaaagatgagaaactaattctcagcagtgaa
gagaagtttttgattggtaaaaatgaagaaaaggtaattgccaaaaccttagaactaaaa
ccatttaaatattgggatatagaagacccatatctttataaaattcaagcaactattatt
tgtgatgagagtattgaagatagtgcttctacattgtttggtattcggacaatttcagtt
gatcccaaggaaggatttaaattaaatggtaagccattaaaattaaaaggtggctgtatt
catcatgacaatggaccacttggaagtgcgagttacgatagggcagaagagagaaaagta
gaacttttaaaagcttctggattcaatgcggtaagacttgcacataatccttttgctcca
gcttttttggatgcatgtgatagattagggatgcttgtgatagaagaattttttgatgta
tggcatgctggcaaggttagctttgactaccatctattttttgacaagtactgggaagaa
gatttggagtccaccataatgagggactataatcatccttcgataataatgtggtcaata
ggaaacgagattacatggggagttggagttgatgttgatgacgatagtagctactcaata
tacacctggtgtgaacgattagcaaaaaaggtaaaaagtttggattcatcaaggctaata
acagcggcactgtgcgcaattccggatgattataaaaggctttttgctataattgaagaa
ggtaactatgtaattagaatgctaaaacaagaagtagatgttattgaagataaatggggc
gagttttcagagaagttttcaagatttctggatgtagttggttataactataaagtagat
agatatggattcgataggtataaatatcctgaccgagtaatctgtggcacagaaacttat
ccatatactctttttaaaaactggaaacaaacaatagaaaattcaaatgttataggtgat
tttgtgtggacggctattgattatttgggcgaagcaggtcttggtagggtaagtattgaa
gcagatgaccttaaatctttctgcgggtcttatccatggtttttagcaaattgtggggat
attgatatttgtggggaaaaacgtcctcaatcgtattatagagatgttgtttggggaaat
agaaaagacccttatattgtaatacttccaccgcaagtttatggcaaaaaactatatttt
aaaccctgggcatgggaaccggtcgaaagaaactacacttttcctggatatgaagggatg
aaggtggctatacatgtctatgcagatgcagatgaggttgagctgtttgtaaatggcaga
agtttgggaagaaaagaagtagggattaatactcagtttaaaatggtttatgacacaatt
tatgaaccaggagtgatagaagctgtagcatacaaagatggtaaagagattggcagagac
aaaatagaaacaacaggtgagcccgtagccttaaaactggtgcctgatagagaagttata
tcctcttcttatggtgatttgtgctatataaaaataatggcagtagatagaaagggaaga
gaggttgtttttgcagataacagaatagttgtagaagttgaaggtgttggcgaacttgtt
gctttaggaagtagcaatcctttgtcaacagaaccatttgttagccgagagagaaagctc
tataaggggcgagcattggcaatagtaaagagcattggcaaaaaaggagaatttaaattg
aaagcttgggcagaaggattggatggtgcacaagtttttgtaaaatgcatttaa

DBGET integrated database retrieval system