KEGG   Caldicellulosiruptor bescii: Athe_1104Help
Entry
Athe_1104         CDS       T00857                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Athe_1104
  Lipid metabolism
   00561 Glycerolipid metabolism
    Athe_1104
   00600 Sphingolipid metabolism
    Athe_1104
Enzymes [BR:ate01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Athe_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1196600..1197916
Genome map
AA seq 438 aa AA seqDB search
MLKIAIIGAGSGVFTRNLVRDILSYPELRNSTIALMDIDSIRLEFMRKALQKLIEQEKYP
TKLEATTDRKEALKGAKYVIVTIQIGGLKPFEYDIYIPLKYGVKQAVGDTIGPGGVFRAL
RTILVLLDIAKDMEELCPDALLLNYVNPMAMNCWALNKATNIKNVGLCHSVQGTAEFLAK
IIGAKMEEISYLCAGINHMAWFLKFEWNGKDAYPLIREKASDPEIYTQDVTKFEILKHFG
YYVTESSFHMSEYVPYFRKSDDWINKIHRTHSWHKEHYNGMYLHCCLDAAKTLLEDLRKM
AEADYIDPKRSNEYCATIIHSIETNTPAVINGNVENKGLITNLPEGCCVEVPCLVDKNGI
QPTYVGNLPPQLAALNRTNINVQELTVLAALTGDREAVYHAIMMDPLTSAVLDLDQIRQM
VDEMFEAEKEWLPEKFYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatagctatcataggtgcaggaagtggagttttcacaaggaacttggtaaga
gacattttgtcatatccagagctaagaaactctacaatagcgcttatggacattgacagt
ataaggcttgaatttatgagaaaagctctgcaaaagctcattgaacaggaaaagtatcct
actaaacttgaagctacaactgatagaaaagaggctttgaaaggtgcaaaatatgttatt
gtcacaatacagattggaggtttaaaacctttcgagtatgacatttacattcctctaaaa
tatggtgtaaaacaggcagttggtgatacaataggtccgggtggagttttcagggctttg
cgaacaatactggttttacttgacattgcaaaggacatggaagagctgtgtcctgacgca
cttttgctcaattatgtaaatccaatggcaatgaattgctgggcgttaaataaggctacg
aatataaaaaatgtagggctttgtcacagtgttcaaggaactgctgaatttttagcaaaa
attattggggcaaaaatggaagaaatttcatacttatgcgcaggtataaaccatatggca
tggtttttaaaatttgagtggaatgggaaagatgcatatcctcttataagggaaaaagca
agtgaccccgaaatctatacacaggatgttacaaaattcgaaatactaaaacattttgga
tattatgtaacagagtcaagttttcacatgtctgaatatgttccctattttagaaagagc
gacgattggataaataaaatccatagaacacattcatggcacaaagaacattacaatggt
atgtatctgcactgctgtttagatgctgcgaaaactttgcttgaagacctgaggaaaatg
gcagaggcagactacatcgaccccaagagaagtaacgaatactgtgcaactatcatccat
tccatagagacaaatactccagctgtgataaatggtaatgttgaaaacaaaggtttaata
acaaatctacctgaaggatgttgcgttgaagtaccatgtttggttgacaaaaatggtatt
cagccaacttatgttggaaatctaccaccacagcttgcagctttgaacagaacaaacata
aacgttcaagagctaactgttcttgctgctttgacaggtgatagggaagcagtttatcat
gcaattatgatggaccctctcacaagtgctgttttggatttagaccagatacgccagatg
gtagatgagatgtttgaagctgaaaaagaatggctgccagaaaagttttataggtaa

DBGET integrated database retrieval system