KEGG   Caldicellulosiruptor bescii: Athe_1115Help
Entry
Athe_1115         CDS       T00857                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ate00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Athe_1115
Enzymes [BR:ate01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Athe_1115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1209930..1210523
Genome map
AA seq 197 aa AA seqDB search
MIDSIVGIIQEVFSNYVILNYNNLYIKIFCNSTKFSEFLGKEKRVYVSLKFNENLSELEC
YGFLTREERELFLKLQKVTGVGSKLALQILSSIDFQELIVEIAKGNVAKLEKVKGIGKKT
ASRIILELKETLKKEFKVASTSGKEEKTYEKLEEISLALLSLGYDIDEVNQVLSSEDFSE
LSLEDGIKLALKKLSKI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatagattctattgtgggaataattcaagaggtatttagtaattatgttatcctcaat
tacaataacctatacataaaaatattttgtaatagcacaaaattctctgaatttttaggc
aaagaaaaaagagtgtatgttagcctaaagtttaatgaaaatttatcagagcttgaatgt
tatggttttttgacaagagaggaaagagagctttttttaaagctacagaaggtaaccggt
gttggcagcaaattagctcttcagattctttcttcaatagactttcaagagcttattgtt
gagattgcaaagggaaatgtggcaaaacttgagaaggtaaaaggaattggaaaaaaaact
gcaagcaggataattcttgagctcaaagagacactcaaaaaagaattcaaagtggcttct
acttcaggtaaagaagaaaaaacttacgaaaaacttgaagaaatatctttagcactttta
tccttggggtatgacattgatgaagtcaaccaggttctttcatccgaagatttttctgaa
ctttctttggaagatggaataaaacttgctttgaaaaagttatcaaagatttga

DBGET integrated database retrieval system