KEGG   Caldicellulosiruptor bescii: Athe_1144Help
Entry
Athe_1144         CDS       T00857                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ate  Caldicellulosiruptor bescii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ate03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1240385..1240990
Genome map
AA seq 201 aa AA seqDB search
MKMQQKENAISKLIQQLEKLPGIGQKTAQRLAFHIINMKTEDVKALADAILSAKTSTKLC
RVCCNFTEDEVCPICKDEKRDKSIICVVEEPQDVAALERVKEYKGLYHVLHGAISPLKGK
YPEQLTIDVLLKRLSDPQIKEVIIATNPDVDGEATASYLARLIKPMGIRVTRIARGIPVG
GDIEYADEVTILKAIEGRREI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcagcaaaaagaaaatgctatatcgaaactaattcagcagcttgaaaagctt
ccgggaattgggcaaaaaactgcccagaggcttgcatttcatatcattaacatgaaaact
gaagatgtcaaggcacttgctgatgctatcttgagtgctaaaaccagcacaaaactgtgc
agagtgtgctgtaactttacagaagacgaggtatgtcctatctgtaaagacgagaaaaga
gacaaaagtattatctgtgttgtggaagaaccacaggatgttgcagcacttgaaagagta
aaggaatataaaggactatatcatgtattgcacggtgcgatatccccgctcaaaggtaag
tatcctgaacagcttacgattgatgttttgctaaaaagactttctgacccacaaatcaag
gaggttataattgccacaaatcctgacgttgacggtgaggcaactgcctcctacttagcg
aggcttataaaaccaatgggtatcagggttacaagaattgccagaggaattccagttggt
ggggacattgagtatgctgatgaggttacaattcttaaagcaatagaaggaagaagagag
atttag

DBGET integrated database retrieval system