KEGG   Caldicellulosiruptor bescii: Athe_1151Help
Entry
Athe_1151         CDS       T00857                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Athe_1151
   00052 Galactose metabolism
    Athe_1151
   00500 Starch and sucrose metabolism
    Athe_1151
   00520 Amino sugar and nucleotide sugar metabolism
    Athe_1151
Enzymes [BR:ate01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Athe_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1244038..1244946
Genome map
AA seq 302 aa AA seqDB search
MKRIIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEALESGIESILIVTGR
GKRAIEDHFDKSFELEVALENKKDYDNLQLIRKIADYNVHYIRQKEPRGLGDAVYCARLF
IDNEPFAVLLGDDIIISEKPCLKQLIEVYEEYRTTILGVQKVSDDDVSKYGIVAGKQIED
RIYKVKDLVEKPKKEEAPSNIAVLGRYIITPEILNILEDTKEGVGGEIQLTDALRELSKK
EAMYAYEFEGKRYDVGNKLGFLQATVEIALSRKDIGKDFYNYLVTLVNAKNYKEKLHEIE
EI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaattattaaaaaagcaatcattcctgcggcaggacttggaacaaggtttttg
ccggcaacaaaggcacagccaaaagagatgcttcccattgtggacaagccaacaattcaa
tacatagttgaagaagcgttagaatcggggatagagagtattttaattgtcacagggcgt
ggcaaaagagcaattgaagaccactttgacaagtcttttgagcttgaagttgcacttgaa
aacaaaaaggattatgataatcttcagctaataagaaaaatagcagactacaatgttcat
tacatacgtcaaaaagagccaagaggacttggtgatgcagtatactgtgcaagacttttt
attgacaatgaaccttttgcagttttgcttggtgatgatatcatcatttctgaaaagcca
tgtttgaaacagctgatagaggtgtatgaagagtacaggacaaccatcttgggtgtgcaa
aaagtatcagatgatgatgttagcaagtatggaattgtggcaggaaaacaaatagaagat
agaatctataaggtaaaggaccttgttgaaaaaccaaaaaaggaagaagcaccttcgaat
atcgctgtgcttggaagatatatcatcacacctgagatattaaatatcttagaagacaca
aaagaaggtgttggtggagaaatacagctgactgacgctttaagagaactttcaaaaaaa
gaagctatgtatgcttatgagtttgaagggaaaagatatgatgtgggcaataaacttgga
tttttgcaagcaacagtcgagattgctctttcaagaaaagacattggcaaagatttttac
aattatcttgttactcttgtaaatgccaaaaattataaagagaaattacacgaaatagaa
gaaatttaa

DBGET integrated database retrieval system