KEGG   Caldicellulosiruptor bescii: Athe_1265Help
Entry
Athe_1265         CDS       T00857                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Athe_1265
   01230 Biosynthesis of amino acids
    Athe_1265
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Athe_1265
   00030 Pentose phosphate pathway
    Athe_1265
   00051 Fructose and mannose metabolism
    Athe_1265
   00052 Galactose metabolism
    Athe_1265
  Energy metabolism
   00680 Methane metabolism
    Athe_1265
Enzymes [BR:ate01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Athe_1265
Protein phosphatases and associated proteins [BR:ate01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Athe_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1355747..1356715
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKFGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKDEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKTIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggcgatgcaccaggaatgaat
gctgctattcgcgctgttgtgagaactggtatatactatggatttagagtaatgggtata
agacgaggttataatggtcttattgaaggcgatatttttgagatgaacttaaggtctgtt
tcagatataatccaacgtggtggaacaatccttttgactgcaaggtctcctgagtttatg
acagaaaatggactcaaaaaagctgcttcaatgtgtaaaatctttaaaatagatgctctt
gttgtaattggcggagacgggtctttcagaggggcaagagacttaagtaaatttggcatc
aacgttgttggaattcccggaactatcgacaatgatatcgcatgtacagactacactatt
ggttttgatacagcattgaatactgtccaggatgcaattaacaagataagagacacagca
acctctcatgaaagagttagtattcttgaggtaatgggacgtcatgcgggatatattgct
ctttatagtggcattgcaggcggtgctgagtcgatcgtaattcccgaaaaaggtcttgac
aaggatgagataataagaagaataattgatggaaaaaacaaaggaaagcttcacaacttg
atcatattggctgagggaattggtggagcaacagagcttgcaaaggagattgaagaagcg
actggaatagagacaagagcgaccatccttgggtatattcagagaggtggctcgcctact
gcgtatgacagagttgttgcaagtttgatgggggcaaaagctgttgaggttatcaaggaa
gggaagcagaacaggataattgcaatgaaggatggaaagattgttgattatgatattgac
gaagcactttctatgcaaaagacaattgatgaatacatgtacaatttagctactatcctt
tctttataa

DBGET integrated database retrieval system