KEGG   Caldicellulosiruptor bescii: Athe_1265Help
Entry
Athe_1265         CDS       T00857                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00010  Glycolysis / Gluconeogenesis
ate00030  Pentose phosphate pathway
ate00051  Fructose and mannose metabolism
ate00052  Galactose metabolism
ate00680  Methane metabolism
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
ate01120  Microbial metabolism in diverse environments
ate01130  Biosynthesis of antibiotics
ate01200  Carbon metabolism
ate01230  Biosynthesis of amino acids
ate03018  RNA degradation
Module
ate_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Athe_1265
   00030 Pentose phosphate pathway
    Athe_1265
   00051 Fructose and mannose metabolism
    Athe_1265
   00052 Galactose metabolism
    Athe_1265
  Energy metabolism
   00680 Methane metabolism
    Athe_1265
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Athe_1265
Enzymes [BR:ate01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Athe_1265
Protein phosphatases and associated proteins [BR:ate01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Athe_1265
Messenger RNA biogenesis [BR:ate03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Athe_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACM60365
JGI: Athe_1265
UniProt: B9MRR1
Position
1355747..1356715
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKFGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKDEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKTIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggcgatgcaccaggaatgaat
gctgctattcgcgctgttgtgagaactggtatatactatggatttagagtaatgggtata
agacgaggttataatggtcttattgaaggcgatatttttgagatgaacttaaggtctgtt
tcagatataatccaacgtggtggaacaatccttttgactgcaaggtctcctgagtttatg
acagaaaatggactcaaaaaagctgcttcaatgtgtaaaatctttaaaatagatgctctt
gttgtaattggcggagacgggtctttcagaggggcaagagacttaagtaaatttggcatc
aacgttgttggaattcccggaactatcgacaatgatatcgcatgtacagactacactatt
ggttttgatacagcattgaatactgtccaggatgcaattaacaagataagagacacagca
acctctcatgaaagagttagtattcttgaggtaatgggacgtcatgcgggatatattgct
ctttatagtggcattgcaggcggtgctgagtcgatcgtaattcccgaaaaaggtcttgac
aaggatgagataataagaagaataattgatggaaaaaacaaaggaaagcttcacaacttg
atcatattggctgagggaattggtggagcaacagagcttgcaaaggagattgaagaagcg
actggaatagagacaagagcgaccatccttgggtatattcagagaggtggctcgcctact
gcgtatgacagagttgttgcaagtttgatgggggcaaaagctgttgaggttatcaaggaa
gggaagcagaacaggataattgcaatgaaggatggaaagattgttgattatgatattgac
gaagcactttctatgcaaaagacaattgatgaatacatgtacaatttagctactatcctt
tctttataa

DBGET integrated database retrieval system