KEGG   Caldicellulosiruptor bescii: Athe_1405Help
Entry
Athe_1405         CDS       T00857                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00010  Glycolysis / Gluconeogenesis
ate00051  Fructose and mannose metabolism
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
ate01120  Microbial metabolism in diverse environments
ate01130  Biosynthesis of antibiotics
ate01200  Carbon metabolism
ate01230  Biosynthesis of amino acids
Module
ate_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ate_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Athe_1405
   00051 Fructose and mannose metabolism
    Athe_1405
   00562 Inositol phosphate metabolism
    Athe_1405
Enzymes [BR:ate01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Athe_1405
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Athe_1405
Exosome [BR:ate04147]
 Exosomal proteins
  Proteins found in most exosomes
   Athe_1405
  Exosomal proteins of colorectal cancer cells
   Athe_1405
  Exosomal proteins of bladder cancer cells
   Athe_1405
  Exosomal proteins of melanoma cells
   Athe_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM SIS_2
Motif
Other DBs
NCBI-ProteinID: ACM60503
JGI: Athe_1405
UniProt: B9MS49
Position
complement(1487543..1489495)
Genome map
AA seq 650 aa AA seqDB search
MPKLNKKTIRDIDVSGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVIL
VSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKEGDVVLLEN
VRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIE
MLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKS
KCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIG
NTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDS
AAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACLLDKNPRKKIIAANWKMNKTPIE
AKEFVEELKKYIDDVQAEVVICAPSILVPYVKEAIEGTNIKLGTQNMFYEEKGAYTGEIS
GPMLKEVGVEYVVIGHSERRQYFGETDEIVNKKVLAALKFGIKPIVCVGETLKQREYGIT
DELVRLQVKIALNGVSKEDVEKVVIAYEPIWAIGTGKNATPEEANRVIGVIRNVIAEIYD
EDTAQKVRIQYGGSVNSANSADIFNMPEIDGGLVGGASLNAQEFAKILHY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagctcaacaaaaagaccataagagatatagatgttagtggcaaaagagttctt
gtgagggttgattttaacgttccacaagatgaaaatggtaatatcactgacgatagaaga
ataagagaagctcttcctacaataaagtatctcattgaccacaacgcaaaggtaatattg
gtatcccatttgggaagaccgaagggcaaatttgacccgaaatactcgatggctcctgtt
gcaaaaagactttctgagcttctcggcaaggaagttgttcttgcaaaagacgttataggc
gatgatgcaaaaaagtgtgttgagcagatgaaagaaggagatgtagttcttcttgaaaat
gtcagattccacaaagaggaagaagaaaatgatagagaatttgcaaaggctttagcctcg
cttgcagacatttatgtcaatgacgcatttggtacagctcacagagcacatgcatcaaca
gcaggtgttgcagagttcttgcctgcagttgctggatttttgatggaaaaagagatagaa
atgcttggcaatgctcttgcaaatccgcaaagaccttttgttgcaatcttgggtggcgca
aaagtttctgataagattggggttattacaaatcttcttgaaaaggttgatagtctctta
attggcggtgcaatggcttataccttcttgaaggcaaaaggatataaaatcgggaagtca
aaatgcgaagatgataagcttgatgttgcaagagagataatgaaaaaggcagaggaaaaa
ggagtaaaccttctgctgcctgttggaagcatagtagcaaaagagtttaaaaatgataca
gagtttatgtacgtaccatcagatgcaatgccagacgatatgatgggtatggacataggg
aataccacaattgagcttttctcaaaagagataaagaaggcaaagaccattgtttggaac
ggaccaatgggtgtatttgaatttccaaactttgcaaagggaacagaagctatcgcaaga
gctgttgctgaggctgttgaagaaaatggcgcaattgcaattatcggtggtggcgactct
gcggctgctgttgaaaaactggggtttgctgataagatgacacatatttcaacaggtggc
ggtgcttcattagagttcttggaaggcaaagttttaccaggtattgcatgtcttcttgat
aaaaatccaagaaaaaagataatcgcagcaaactggaagatgaacaagactcctattgag
gcgaaagagtttgttgaagagctgaaaaaatatattgatgatgttcaggcagaagtagtt
atctgtgctccatcaattcttgttccttatgttaaagaagcaatagaaggaacaaatata
aaacttggaacacaaaacatgttctatgaagaaaaaggtgcatatacaggtgagatctca
ggtccaatgttaaaggaagttggagttgagtatgtggtaattggtcactctgaaagaagg
cagtactttggtgaaactgatgagattgtgaacaagaaagtgttagcagcgctcaagttc
ggtatcaagcctattgtatgtgttggtgagacacttaagcaaagagaatatggtattaca
gatgagcttgtaaggcttcaggtcaagattgcactaaatggtgtctcaaaagaagatgtt
gaaaaggttgtcattgcatatgagcctatctgggcaataggtacaggtaagaatgcaaca
cctgaagaggcaaatagagtaattggggttatcagaaatgtaattgcagagatttacgat
gaagatactgcgcaaaaggttagaattcagtatggcggtagtgtaaactctgcaaattca
gcagacattttcaatatgccagagattgatggaggcttagttggcggtgcaagccttaat
gctcaggaatttgcaaagatattacactactaa

DBGET integrated database retrieval system