KEGG   Caldicellulosiruptor bescii: Athe_1539Help
Entry
Athe_1539         CDS       T00857                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Athe_1539
Enzymes [BR:ate01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Athe_1539
Peptidases [BR:ate01002]
 Cysteine Peptidases
  Family C44
   Athe_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1625379..1627214
Genome map
AA seq 611 aa AA seqDB search
MCGFSGWICFSSDISEFQDVITKMTDVLSHRGPDEEDYYITKHALLGHKRLTIIDPEGGK
QPMIKFHGQEKFIIVYNGELYNTQELRAKLQSLGYYFSSYSDTEVVLTSYIQWKEECVKY
LNGIFAFAVFNETKNELFISRDHLGVKPLFFSIKNENFIFASEIKALLKHPLISTKVNKE
GIFELIGLCPARSPFSAIFKDIIELPPAHYVIYSKNRYEIKEYWQLKPEKFDNTVDETIE
IVKNLVTDTITRQLVSDFEICCFLSGGLDSTIITAISANQLRKEGRRLKSFSIDYKDNAK
YYKLNQYQPTLDSTYAKIASKSIGTDHIVVEIDNELLCNALTLATVANDLPGMADIDSSL
LLFTNEVRKYAKVALSGECADEIFGGYPWYWREDYKNFETFPWSPSLEFRKNLLSQKYSK
SELEEYVNSKYKESVGKVNYLDSDSQEDVRQRILYYLNVKWFMVTLLNRKDRMSMANSLE
VRVPFADYRIVELLYNVPWKIKYLENMEKGLLRRSFEGIIPDEIKNRKKSPYPKTYNPEY
FKKTKQKVLEIIKNNSPIFEIIDKTYLENISVKEYFPLDKPWFGQLMTLPQFFGYIIQLD
YWAQTYNVDFE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggatttagcggatggatatgttttagctcagacatttctgaattccaggatgta
ataacaaagatgacagatgtacttagtcaccgcggacctgatgaagaagactattatatc
accaaacatgctctgctcgggcacaaacgactcaccattattgaccctgaaggtggcaaa
cagccaatgatcaaatttcatggccaagaaaaattcattatagtctataacggtgagctt
tacaatactcaagaacttcgggcaaagcttcaaagcttagggtattatttcagttcatac
tcagataccgaagttgtgttgacttcatatattcaatggaaagaagagtgtgtgaaatat
ttaaatggtatatttgcttttgcagtttttaatgaaaccaaaaatgagctttttatatct
cgggatcatttaggagtaaaaccgctatttttctctattaaaaatgagaattttattttt
gcttcagaaataaaagctcttttaaagcaccctttaatatccacgaaggtaaacaaagag
ggtatttttgagcttataggtctttgtcctgcaaggtctccattttcagcaattttcaaa
gatattatagaacttcctcccgcacattatgtaatatacagcaaaaatagatatgaaata
aaagaatattggcagttaaaacccgaaaagtttgacaacacagtagatgaaactattgag
atagttaaaaaccttgtcacagatacaataacaaggcagcttgtttctgactttgaaata
tgttgctttttgtcaggcgggttggattcaaccattattacagctatttctgccaaccag
ttaagaaaagaaggaagaagattaaaaagtttttctattgattataaggataacgcaaaa
tattataaattaaatcagtatcaacctaccttagacagcacctatgccaagatagcttca
aaaagtataggtacagaccacattgtagttgaaattgacaatgaactcttatgcaatgcc
ctcacccttgccacagttgcaaatgaccttcctggcatggctgacattgactcatcactt
ctcttgtttacaaatgaagtgagaaaatatgcaaaggttgccctatcgggtgagtgtgct
gacgagatttttggcggatatccttggtattggagagaggattacaaaaatttcgaaacc
tttccatggtcgccttcattagaatttagaaaaaatcttctgtcacaaaaatattcaaaa
tcagagcttgaagagtatgttaactcaaagtataaagagtcggttggaaaagtaaactat
cttgacagtgactctcaggaagatgtaagacaaagaattttgtactacttgaacgttaag
tggtttatggtaacacttttaaacagaaaagatagaatgagcatggcaaattctttggag
gtaagagttccatttgcagattatagaattgtagagcttttgtacaatgttccgtggaag
ataaaatatcttgaaaatatggaaaaaggacttttaagacgctcatttgaaggaattatt
cctgatgaaataaagaatcgcaaaaagagcccttatcctaaaacctataatccagagtat
tttaaaaaaacaaagcaaaaggttttagagattataaaaaataattctcctatatttgag
ataatagataagacttacttggaaaacatatcagtgaaagaatattttcctttagataaa
ccttggtttggtcaactaatgaccctcccacagttttttggatatatcatccagcttgat
tattgggcacagacctacaatgtagatttcgaataa

DBGET integrated database retrieval system