KEGG   Caldicellulosiruptor bescii: Athe_1690Help
Entry
Athe_1690         CDS       T00857                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Athe_1690
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Athe_1690
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Athe_1690
Enzymes [BR:ate01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Athe_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1777454..1778224)
Genome map
AA seq 256 aa AA seqDB search
MNFIDERFERLKKEGKKAFIGYVTFGYPTFEETLWFIKLVYSYVDILEIGFPFSDPIADG
EIIQKASIKALSEGVKLSHLFESIEKFKKDKPVVLMLYANTVYKRGIDRFFESCKACGVD
GVIIPDVSFEESFEFKEVAEKFGIVYIDLVSISSLERAKMIGRQSRGFLYCVSRKGVTGF
KGQIDDRIFTFLKELKTVTSTPLAVGFGIKSKEDVQKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKDK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaattttatagatgaaagatttgaaaggctaaaaaaagagggaaaaaaagctttcata
ggctatgttacgtttgggtatccaacttttgaagaaacactttggtttataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatgga
gaaattattcaaaaagcttctataaaagctctcagtgaaggtgtcaaattgagccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgttgtatgcaaac
acagtttacaaaaggggaattgatagattttttgaaagttgcaaagcttgcggtgtggat
ggcgtgataatcccagatgtttcgtttgaagagagctttgagttcaaagaagtagctgaa
aagtttggtattgtctatattgaccttgtatcaatatcttctcttgagagagccaagatg
ataggtaggcagagccgtggttttttgtattgtgtttcaagaaaaggtgtgacaggtttc
aaagggcagattgatgataggatttttacttttctaaaagaactaaaaaccgttacctca
acacctttagcagttggatttggtataaagagtaaagaagatgtgcaaaagttcaaagac
cttgcagatggtattgtcattggaagtgcaataatcacaaagatagatgaaggaaaagac
aaacttgaagattttttgaaagaaatctcagaaagtctaaaagacaaataa

DBGET integrated database retrieval system