KEGG   Caldicellulosiruptor bescii: Athe_1709Help
Entry
Athe_1709         CDS       T00857                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00010  Glycolysis / Gluconeogenesis
ate00020  Citrate cycle (TCA cycle)
ate00620  Pyruvate metabolism
ate00633  Nitrotoluene degradation
ate00640  Propanoate metabolism
ate00650  Butanoate metabolism
ate00680  Methane metabolism
ate01100  Metabolic pathways
ate01120  Microbial metabolism in diverse environments
ate01130  Biosynthesis of antibiotics
ate01200  Carbon metabolism
Module
ate_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Athe_1709
   00020 Citrate cycle (TCA cycle)
    Athe_1709
   00620 Pyruvate metabolism
    Athe_1709
   00640 Propanoate metabolism
    Athe_1709
   00650 Butanoate metabolism
    Athe_1709
  Energy metabolism
   00680 Methane metabolism
    Athe_1709
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Athe_1709
Enzymes [BR:ate01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Athe_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_6 Fer4_7 Fer4_16 Fer4_9 Fer4_21 Fer4_2 Fer4_10 Fer4_4 Fer4_8 Fer4_22 Fer4_17 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ACM60803
JGI: Athe_1709
UniProt: B9MKE5
Position
complement(1798859..1799878)
Genome map
AA seq 339 aa AA seqDB search
MLPITNELGYYEIRLESIGGLGANVAGKILAEAGVVGSGLNALNFASYGSEKKGSPVKSY
IRFAPKEKRIRINSPVVQPHLVAIFHENMVNTNPVTQGLRKDGIVILNTSKSVDEARDFL
KLASGKVATVDAIRIALEVKTRINMVMLGAIVRMLGFISLDSVKEIVKQTFEKKYPQTIA
SNMAGLEAGYNYVESKFFEYDGKYQYVEYQEERRPMGYKNAPIGGTIVEYGNTITKNNIT
SRIGKIPVFIKEKCINCGLCETTCPDYVFVWDRKAENGKLKMFNLGPDYQYCKGCLRCVD
ICPTGALVEGIEREYDIGKISAKHDFDIYVKWYEDGEKR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttacctattaccaacgagcttggatattacgaaatccgacttgaaagtattggcgga
cttggtgcaaatgttgcgggcaaaattttggctgaggcaggtgttgttggaagtggactg
aatgccttaaattttgcaagttatggctctgaaaagaagggttcacctgtaaagtcgtat
ataagatttgctcctaaggaaaaaagaataagaattaattcgcctgttgttcagcctcat
ttggttgctatatttcacgagaatatggtaaatacaaaccctgtcacacaaggacttaga
aaagatggaatagttatcctgaacacaagcaagagcgtggatgaggctcgtgacttttta
aaacttgcaagtggcaaggtggcaacagtggatgcgataaggattgctcttgaagttaaa
acaaggattaacatggttatgcttggggcaattgtaagaatgcttgggtttattagctta
gatagtgtaaaagagattgttaaacaaacttttgagaaaaaatatccgcagacaattgcg
tccaacatggcaggtcttgaagctggatataactatgtagaatctaagttttttgaatat
gatggtaaataccaatacgtagagtaccaagaagaaagaagacctatgggatataaaaac
gctccgattggaggaactattgtagagtatggaaacacaataacaaaaaacaatataacc
agcagaattgggaaaattcctgtgtttataaaagaaaaatgcatcaactgtgggctttgt
gaaactacgtgtcctgattatgtctttgtttgggatagaaaggcagaaaatggcaagtta
aaaatgtttaatttagggcctgattatcagtattgtaaagggtgtcttagatgtgttgac
atttgtcctacaggtgcacttgttgaaggtattgaaagggaatatgatataggaaaaatc
tctgcaaaacatgattttgatatatacgtaaaatggtatgaggatggtgagaagagatga

DBGET integrated database retrieval system