KEGG   Caldicellulosiruptor bescii: Athe_1865Help
Entry
Athe_1865         CDS       T00857                                 

Definition
glycoside hydrolase family protein
Orthology
K01218  
mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Athe_1865
Enzymes [BR:ate01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     Athe_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1959955..1964064)
Genome map
AA seq 1369 aa AA seqDB search
MLKLKRAIKMITFCVAMVFLLQVFFLFSGYNNSEVKAATTFNYGEALQKAIMFYEFQMSG
KLPSWIRNNWRGDSGLNDGKDVGLDLTGGWHDAGDHVKFNLPMSYSASMLSWAVYEYKAA
FEKSGQLEHILNQIEWVNDYFVKCHPSKYVYYYQVGDPIEDHNFWGPAEVMQMKRPAYKC
DLNNPASSVVAETAASLAAASIVIRERNSQKADTYLQHAMVLFDFADRTRSDAGYTAATG
FYTSGGFIDDLGWAAVWLYLATNDKSYLDKAEALMAEYAGGTNTWTQCWDDVRYGAILLL
AKITNKDIYKGAVERNLDHWTYNITYTPKGLAWITGWGSLRYATTAAFLAFVYADWSGCP
ENKRTAYLKFGESQINYALGSTGRSFLVGFGQNYPQHPHHRNAHSSWANSMRIPEYHRHI
LYGALVGGPGSDDSYNDDITDYVQNEVACDYNAGIVGALAKMYLMYGGDPIPNFKAIEKP
TNDEIFVESKFGNSQGTNYTEIISYIYNRTGWPPRVTDNLNFKYFIDLSELIKAGYGPDV
VKVETYYSEGGKISGPYVWNASKNLYYILVDFTGTKIYPGGEVEHKKQAQFKISVPQGVP
WDPTNDPSYAGLTKELSKNKFIAAYEGNVLVWGQEPEGSSSSTPTPTPTPTPTLTPTPTS
TATPTPTPTPTPTSTPTATPTATPTPTPTPSSTPVAGGQIKVLYANKETNSTTNTIRPWL
KVVNTGSSSIDLSRVTIRYWYTVDGDKAQSAISDWAQIGASNVTFKFVKLSSSVSGADYY
LEIGFKSGAGQLQAGKDTGEIQIRFNKSDWSNYNQGNDWSWMQSMTSYGENVKVTAYIDG
VLVWGQEPSGATPTPTATPAPTVTPTPTPAPTPTPTPTPTATPTPTPTPTPTPTATPTPT
PSSTPVAGGQIKVLYANKETNSTTNTIRPWLKVVNTGSSSIDLSRVTIRYWYTVDGDKAQ
SAISDWAQIGASNVTFKFVKLSSSVSGADYYLEIGFKSGAGQLQAGKDTGEIQIRFNKSD
WSNYNQGNDWSWMQSMTSYGENVKVTAYIDGVLVWGQEPSGATPTPTATPAPTVTPTPTP
TPTPTPSSGIVKIDTSTLIGTNHAHCWYRDKLETALRGIRSWGMNSVRVVLSNGYRWTKI
PASEVANIISLSRSLGFRAIVLEVHDTTGYGEDGAACSLAQAVEYWKEIKSVLEGNEDFV
IINIGNEPYGNNNYQNWINDTKNAIKALRDAGFKHTIMVDAPNWGQDWSNTMRDNAQSIM
EADPLRNLVFSIHMYGVYNTASKVEEYIKSFVEKGLPLVIGEFGHQHTDGDPDEEAIVRY
AKQYKIGLFSWSWCGNSSYVGYLDMVNNWDPNNPTPWGQWYKTNAIGAE
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaactaaaaagagcaataaaaatgattacattttgtgttgctatggtatttcta
ttgcaggttttctttctattttcaggatataataacagtgaagtaaaagcagcaacaacc
tttaactatggtgaagctcttcaaaaagcgatcatgttttatgaatttcagatgtcaggt
aaactaccatcatggatccgtaacaactggcgcggggattctggtctaaatgatggcaaa
gatgtaggtttagatcttactggtggctggcatgatgcgggcgaccatgtaaagtttaat
ctaccaatgtcatacagtgcatcaatgctttcgtgggcagtttatgagtacaaagcagca
tttgagaaaagtggtcagcttgaacatatacttaaccagattgaatgggtaaacgactac
tttgtaaaatgccatccatcaaagtatgtatactactatcaagttggtgacccaattgaa
gatcataacttctggggtccagcagaagttatgcaaatgaaacgaccagcatacaagtgt
gacttaaataatccagcaagttcggttgttgcagaaacagcagcatccttagctgcagct
tcaatcgtcatacgtgaaagaaatagtcaaaaggcagacacatatttgcagcatgcgatg
gtactctttgattttgccgatagaactcgtagtgatgcagggtataccgcagcaacaggc
ttttacacatcaggtggttttattgatgatcttggttgggcagcagtgtggttatatctt
gcgacaaatgacaaatcatatttagataaagctgaggcacttatggcagaatatgccggt
ggcacaaatacatggacacagtgctgggacgatgtaagatacggagcaatattgctttta
gcaaaaattactaataaagacatatataaaggtgctgttgaaagaaatcttgatcattgg
acatataacataacctatacacctaaaggtcttgcatggataacagggtggggctcactt
aggtatgccacaactgcagctttcttagcgtttgtttatgcagattggtcaggatgtcca
gaaaataagcgaacagcttatctaaaatttggtgagagtcagattaactatgcattaggt
tcaacaggaagaagctttttggtaggatttgggcaaaattatccacaacatccacatcac
agaaatgcacacagttcatgggcgaacagtatgcgaatacctgaatatcatcgacacata
ctttatggtgcattagtaggcggaccaggctctgatgatagttacaatgatgatattact
gactatgttcaaaacgaggtggcttgtgactacaatgctggtattgtaggtgctctggca
aaaatgtaccttatgtatggaggagacccaatacctaatttcaaagctatcgaaaagcca
actaatgatgaaatttttgttgaatccaagtttggtaattcacagggtacaaactatacc
gaaataatttcatacatttataacagaacgggatggccgcctcgagtcacagataatcta
aactttaagtattttattgacctaagtgagttaatcaaggctgggtatggtcctgatgtt
gttaaagtagagacatattattcagaaggtggaaaaatatctggaccatacgtatggaat
gcatcaaagaacctttactatatattagttgattttacaggaacaaaaatatatccaggt
ggggaagtagaacacaaaaaacaagctcaatttaagatatctgtgccacaaggtgttcca
tgggatccaactaatgacccatcttatgcaggattaacaaaagaacttagtaaaaataag
ttcatagcagcttatgaaggtaacgtgctggtatggggacaagaaccagagggttcgtca
agttcaaccccaaccccaacaccaacaccaacaccaacactgactccaacaccgacatca
actgctacaccaacaccgacacctacaccaacaccaacgtcaacaccaactgctacacca
acagcaacgccaacaccaacaccgacgccgagcagcacacctgtagcaggcgggcagata
aaggtattgtatgctaacaaggagacaaatagcacaacaaacacgataaggccatggttg
aaggtagtgaacactggaagcagcagcatagatttaagcagggtaacgataaggtactgg
tacacggtagatggggacaaggcacagagtgcgatatcagactgggcacagataggagca
agcaatgtgacattcaagtttgtgaagctgagcagtagcgtaagtggagcggactattat
ttagagataggatttaagagtggagctgggcagttgcaggctggtaaagacacaggggag
atacagataaggtttaacaagagtgactggagcaattacaatcaggggaatgactggtca
tggatgcagagcatgacgagttatggagagaatgtgaaggtaacagcgtatatagatggt
gtattggtatggggacaggagccgagtggagcgacaccaacaccgacagcaacaccagca
ccgacagtgacaccgacaccaacaccagcaccaacaccaaccccgactccaacaccaact
gctacaccaacgccaacaccgactccaacaccaacaccaactgctaccccaacaccgacg
ccgagcagcacacctgtagcaggtggacagataaaggtattgtatgctaacaaggagaca
aatagcacaacaaacacgataaggccatggttgaaggtagtgaacactggaagcagcagc
atagatttaagcagggtaacgataaggtactggtacacggtagatggggacaaggcacag
agtgcgatatcagactgggcacagataggagcaagcaatgtgacattcaagtttgtgaag
ctgagcagtagcgtaagtggagcggactattatttagagataggatttaagagtggagct
gggcagttgcaggctggtaaagacacaggggagatacagataaggtttaacaagagtgac
tggagcaattacaatcaggggaatgactggtcatggatgcagagcatgacgagttatgga
gagaatgtgaaggtaacagcgtatatagatggtgtattggtatggggacaggagccgagt
ggagcgacaccaacaccgacagcaacaccagcaccgacagtgacacctacacctacacca
actccaactccaacgccgagcagtggaatagtgaagatagatactagcacattaatagga
acaaatcacgcacattgctggtacagagataaacttgagacggcattgcgaggaataagg
tcatggggtatgaactctgtgagggtagtgttgagtaatggctatcgatggacgaagata
ccagcaagtgaagtagcaaatattatatcattgtcaagaagtcttggattcagagccatt
gtattagaagttcacgacacgacaggatatggtgaggacggtgcagcatgttcattggcg
caagcagtagaatattggaaagagataaagagtgtgttagaaggcaatgaggattttgtt
ataataaacattggtaatgagccgtatgggaacaataactatcaaaactggattaatgac
acgaagaatgctataaaagcgctaagggatgcagggttcaagcacacgataatggttgat
gcaccgaactgggggcaggattggtctaatactatgagagacaatgcccagagcataatg
gaagcagatccgctgcgcaatttggtattttcgattcatatgtacggtgtatacaataca
gcgagcaaggtagaagaatatatcaagtcatttgtggagaaagggctgccattagttatt
ggggagtttgggcatcagcatacagatggtgaccctgacgaggaagctattgtcaggtat
gcaaaacaatacaagataggactttttagctggtcttggtgtggcaattcgagctatgta
gggtacttggacatggtaaacaattgggaccccaataatccaactccatgggggcaatgg
tataaaactaatgcgattggtgctgaataa

DBGET integrated database retrieval system