KEGG   Caldicellulosiruptor bescii: Athe_1927Help
Entry
Athe_1927         CDS       T00857                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ate00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2034323..2036362)
Genome map
AA seq 679 aa AA seqDB search
MGKIKLKKFLHGGDYNPDQWTEDVWEKDIEYMKYYNVNAVSMPIFSWAQLQPNEDEFTFE
WLDKIIDKLYSNGIHVILATPTASQPAWLSKKYPDVLPVDIHGRKRKHGARQNYCPNSPN
FKNAARRIVEEMVKRYKDHPAVIMWHISNEYGPYCYCENCAKAFREWLKERYKTLDELNK
RWNTAFWGHTFYDWDEIEVPSYLNEEFEYMPGRQKSSFQGPSLDYKRFMSDSLLNLYKME
VEIIKKYMPDIPVTTNLMGPFKPLDYHKWAKHMDIVSWDNYPSIKDSPSSIAFKHDLMRG
LKRDQSWILMEQTPSQTNWHWYNSAKRPGMIRLLSYHAIAHGADSVLYFQWRQSVASCEK
FHSAMVPHVGHLETRVSKELKKIGDELLRLDEILESTTKSEVALLFDWENWWALEESMGF
RNDISYLEHIDAYYKALYKLKTNVDVVDPKEDLTRYKLVVAPLLYLLDKETAKNIENYVK
NGGIFITTYLSGLVDENDRVILGGYPGWFRKLCGIWVEEIDALFPDMKNAIILEKPIGML
DGKYECDFICDVIHLEGARALAYYEQDYYRGMPAVVENNYGNGKAIYIGTRPEQRFIEGL
VKFYAEKAGVQPILLVPEGVEVTKREKNGNEYVFLLNFNGYDVNIELKDEYYELITQKIL
GGKATLAPKEVMILRRLKD
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaataaagctgaaaaaatttttgcatggtggagactacaatccagaccagtgg
acagaggatgtgtgggaaaaggacattgaatatatgaaatactataatgtaaatgcagtt
tctatgccaatattttcatgggcacagcttcagccaaatgaagatgaatttacatttgaa
tggcttgacaaaataattgataagctctattcaaatggtattcatgttatcttggcaaca
cctacggcttctcagccagcatggctttctaaaaagtatcctgatgtgcttcctgttgat
attcatggaagaaagagaaaacatggagcaaggcagaattactgcccaaacagtccaaac
ttcaaaaatgcagcaagaagaattgttgaggagatggtaaaaaggtataaagaccatcct
gcagttataatgtggcatatcagtaacgaatatggtccttactgctactgtgaaaactgt
gcaaaagcctttagagagtggctaaaagaaagatataaaacattggatgagctcaacaaa
agatggaacacagctttctggggacatacattttatgattgggatgagatagaagttccc
tcatatctgaacgaagagtttgaatatatgcctggaaggcagaaaagctcattccaggga
ccttcgcttgattacaagaggtttatgtcagacagccttctgaatctttataaaatggaa
gttgagattatcaaaaaatacatgccagatatccctgttacaacaaacctgatgggccca
tttaagcctcttgactatcacaaatgggcaaaacatatggatattgtatcatgggacaat
tacccatcgataaaagattctccaagttctattgctttcaagcatgacctcatgagaggg
ctcaaaagagaccaatcgtggattttgatggaacaaacaccgagccagacaaattggcat
tggtacaactctgcaaaaagacctggtatgataaggcttttgagctatcatgcaattgca
catggagctgactctgtgctgtatttccagtggagacagtcagttgcttcgtgcgaaaag
tttcactctgcgatggttccgcatgttggacaccttgagacgagggtgagcaaagagctt
aaaaagattggcgatgaacttttgcgcttagatgagattttggagtcaacaactaagagc
gaggttgcactattatttgactgggaaaactggtgggcgcttgaagagagtatgggattt
agaaatgatatatcttaccttgaacatatagatgcttactataaagcgctgtataagcta
aaaacaaatgtggatgttgttgacccgaaagaagatttaacaaggtacaaacttgttgtt
gcaccacttttgtatcttcttgataaagagactgcaaagaatatagaaaattatgtaaaa
aacggtggaatatttattacaacatatttatcaggacttgttgatgaaaatgacagagta
attcttggcggctatccgggttggtttaggaaactctgtggtatctgggttgaggagatt
gatgcgcttttccctgatatgaaaaatgcaattatacttgaaaaacctattggcatgctt
gatggcaaatacgaatgtgattttatctgtgacgttattcaccttgagggtgcaagggcg
cttgcttactatgagcaggattattaccgcggaatgccagctgttgttgaaaataattat
ggaaatggaaaggcgatttatattggaacaagaccagaacaaaggtttatagaaggtctt
gttaagttctacgctgaaaaggctggtgtacaaccaatattacttgtgccggaaggtgtt
gaagtaacaaaaagagaaaagaatgggaatgaatatgtgtttcttttgaatttcaatggt
tatgatgtaaatattgagcttaaagatgagtattatgagcttataacacagaagattttg
ggcggaaaagctactcttgccccgaaggaggttatgatactgagaagattaaaagattaa

DBGET integrated database retrieval system