KEGG   Caldicellulosiruptor bescii: Athe_1997Help
Entry
Athe_1997         CDS       T00857                                 

Definition
carbohydrate kinase FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Athe_1997
Enzymes [BR:ate01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Athe_1997
Exosome [BR:ate04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Athe_1997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2107546..2109063
Genome map
AA seq 505 aa AA seqDB search
MEGILTIDVGTSSLRIIIYDLQGEIKFKAQEEYSMEFYDSRVEQDPNTWKEALLKCFKKT
KDFLKDNNLEIFSVSVTSQRASVIPVDERCEPLYKAIMWQDKRSVKQCEKIEKAIGKEVI
YKKTGLRIDPYFSLPKMLWLKENVPEVFEKAYKLIGVQDYIVYQLTKKFVTDWTQASRLM
IMNIKEFKWDEEILQETGISKSLLCELIPPGTVAGALSQDIAEISNLKTGTPVIIAGGDQ
QCAALALNVLEPGHAEVNTGTGSFIIAYSDNPVFDKEIRTLCSASAVAGKWICEAGMFTT
GSIYRWFKEQFYSWAGEKAFEVMDKEIENVPVGANGVLILPHFEGSAAPYWNPFAKGVIF
NLTLGTKRSEIARAILEGICLELMDNMKIIEENIGSIQNISVAGGMTTFDLFNQMQADAF
NKRIVKYQNVEATSLGAAMSAAVCMGYYKTHREAFEHMAGKVEKIFEPNKENVYLYEKLL
RRKNLLYHALNSYQVYSTFAESLKG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttggaaggcattctaacaattgatgtaggaacttcgagtttaagaattatcatctatgac
cttcagggtgaaataaagtttaaggcacaggaagagtatagtatggagttttacgactca
cgtgttgaacaagaccctaatacttggaaggaagccttgttaaaatgttttaaaaaaacc
aaagattttctgaaggataacaacttagagatttttagcgtatcagtcacatctcaaaga
gcctctgttattccagtagatgaaagatgtgagcccctttataaagctatcatgtggcaa
gataaaagaagtgtaaaacagtgcgagaaaattgaaaaagcaattggtaaggaagtgata
tacaaaaagacaggtttgcgaatagatccttatttttctcttcctaagatgttatggttg
aaggaaaatgttccagaggtttttgaaaaagcatacaaattgataggagtgcaggattat
atcgtctatcaacttacaaagaaatttgtgacagattggacacaagcttctcgtcttatg
attatgaatattaaagaatttaaatgggatgaggaaatattgcaagaaacaggaattagc
aaatctcttctctgtgagttgattccgcctggtacggttgcgggagcattgtctcaagac
atcgctgaaattagtaatttgaaaaccggtacgccggtaatcatagctggtggagaccaa
caatgtgccgctttggcacttaatgttcttgagccggggcatgctgaagtaaatacggga
acgggatcttttataattgcatattctgataatcctgttttcgataaagagattagaacg
ctttgtagtgcttccgcagttgctggaaagtggatttgtgaagcaggaatgtttacaaca
gggtctatttacagatggttcaaagagcagttttatagttgggcaggtgaaaaggccttt
gaagtgatggacaaagagatagagaatgtgccggtgggagctaatggagttttgattttg
ccacattttgagggaagtgcagctccatattggaatccttttgcgaaaggtgtaatattt
aatcttacccttgggacaaaaaggagtgaaattgcaagagcaatattagaaggtatatgc
ttggaattgatggataatatgaaaatcattgaagaaaacataggtagcatccagaatatt
agtgtagcaggcggtatgacaacgtttgatttgttcaaccaaatgcaagcagatgctttt
aataaacggatagtcaagtatcaaaatgttgaagcaacttccttgggagcagcaatgagt
gcagctgtttgtatgggatattacaaaacgcacagggaagcctttgagcacatggcagga
aaagtagaaaagatatttgaaccaaataaagaaaatgtttacttatacgaaaaactgcta
aggcgcaaaaatttactgtatcacgcacttaatagctatcaagtatatagcacttttgca
gaatctttaaaagggtaa

DBGET integrated database retrieval system