KEGG   Caldicellulosiruptor bescii: Athe_2073Help
Entry
Athe_2073         CDS       T00857                                 

Definition
(GenBank) L-fucose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00051  Fructose and mannose metabolism
ate01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Athe_2073
Enzymes [BR:ate01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     Athe_2073
    5.3.1.25  L-fucose isomerase
     Athe_2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N2 Fucose_iso_N1 Fucose_iso_C Bromodomain DUF5025
Motif
Other DBs
NCBI-ProteinID: ACM61150
JGI: Athe_2073
UniProt: B9MLG0
Position
complement(2190311..2192125)
Genome map
AA seq 604 aa AA seqDB search
MLNERLNVFIGEKRFVEDYPKVGIRPTIDGRYGGVRESLEEQTKRLAKAVAEFIENNVYL
PNGEKVKCVLPQMCIGAVVEARMADELFKKEGVGVSITVTPCWCYGTETMDMTLDIPKAV
WGFNGTERPGAVYLAAVSAAHNQKGIPVFKIYGKDVQDRDDFSIPQDVQEKILKFVKSAL
AVSIMKNKSYLSIGSVSMGIAGSIVDPDFFEDYLGMRVEYVDMSEIIRRIEEKIYDQEEF
ERAIQWVRNNCKEGEDPNPPEKRVDRKKKDEVWEFVVKMAIITRDLMISNKKLEALGYPE
EALGHNAILAGFQGQRHWTDHFPNGDFMETILNSSFDWNGLRQPYILATENDSLNGVCML
FGHLLTNTAQIFADVRTYWSPDAIYRVTGWKPEGLAQNGVIHLINSGSAALDGTGQQEID
GKPAIKPFWEITEQEVKKCLDATRFCYANLGYFRGGGFSTKFVTRGGMPVTISRLNIVKG
LGPVLQIAEGWTVELSANVHEILDRRTDPTWPTTWFVPKLTGKGAFKSVYSVMENWGANH
CAITYGHVGDLFITLASMLRIPVCMHNVEEERIFRPSAWSAFGTEDLEGADFRACKNFGP
LYKK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgaaagattgaatgtttttataggtgaaaaaagatttgttgaagattacccc
aaggtgggtataagaccaactatagatgggagatatggtggtgttagagaatctcttgaa
gagcagacaaagagattagcaaaagctgttgctgagtttattgaaaacaatgtgtatctt
ccaaatggcgaaaaagtaaagtgtgtattacctcaaatgtgtattggtgctgttgtagag
gcaagaatggcagatgaacttttcaaaaaagaaggagtaggagtttccataacagtgaca
ccttgctggtgttatggaacagagactatggatatgacattggatattccaaaagctgta
tggggatttaatggtacagaaagaccaggtgctgtatatcttgctgcagtgtctgctgct
cacaatcaaaagggaattcctgtttttaaaatctatggcaaagatgttcaagacagagac
gacttttcaattcctcaagatgttcaagaaaagattttaaagtttgtaaaaagtgctttg
gcagtttctataatgaaaaataagtcttatctttcaattggaagtgtatcgatgggaatt
gcaggttcgattgttgatcctgacttttttgaggactatcttgggatgagagttgagtat
gttgacatgtcagagataataaggcgaatagaagaaaagatatacgaccaagaagaattt
gaaagggcaatacagtgggtgaggaataattgtaaggaaggagaagatcctaatccacca
gagaaaagagttgacagaaaaaagaaggatgaggtatgggaatttgtagtcaagatggct
ataataacaagagatttaatgattagtaacaaaaagcttgaagcattaggttatcccgaa
gaagcacttggacataatgcaattttagcaggatttcaaggacagcggcattggacagat
catttcccaaacggtgactttatggaaacaattcttaactcctcatttgactggaatgga
cttagacagccttacatacttgcaactgaaaatgacagcttaaacggtgtatgtatgtta
tttgggcatttacttacaaatacagctcagatttttgcagatgttagaacatattggagt
ccggatgctatttacagagtaaccggatggaaaccagaaggacttgctcaaaatggggtt
attcatcttataaattctggttctgcagcattggatggaacaggtcagcaagagattgac
ggcaagcctgctataaagcctttctgggaaattaccgagcaagaagttaaaaaatgctta
gatgcaacaagattttgttatgccaatttgggatattttagaggcggtggattttcgact
aagtttgtaacaagaggcggcatgcctgttacaatctcaagattaaatattgttaaaggt
ttagggccagtccttcaaattgcagaaggctggacagtagaactttctgcaaatgttcat
gaaatacttgacagaagaacagacccaacatggcccactacatggtttgtaccaaaacta
actggcaagggagcatttaagagtgtatattctgtgatggaaaactggggagcaaatcac
tgtgcaataacatatgggcatgtaggagatttatttattacacttgcgtcgatgctaagg
attccagtttgtatgcacaatgttgaagaagagaggatcttcaggccaagcgcttggagt
gcgtttggaacagaagacttagaaggtgctgattttagagcatgtaaaaattttggccca
ctttataaaaaataa

DBGET integrated database retrieval system