KEGG   Caldicellulosiruptor bescii: Athe_2244Help
Entry
Athe_2244         CDS       T00857                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Athe_2244
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Athe_2244
  Lipid metabolism
   00071 Fatty acid degradation
    Athe_2244
  Amino acid metabolism
   00350 Tyrosine metabolism
    Athe_2244
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Athe_2244
   00626 Naphthalene degradation
    Athe_2244
Enzymes [BR:ate01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Athe_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2381789..2382976)
Genome map
AA seq 395 aa AA seqDB search
MENLVFNYFIPTKILFGPRSLNRLKDENLPGKKALIVISAGTSMKKYGYLDRLTAILKEK
GIEYVVFDKILPNPIKKHVMEGAKLAKEEGCDFVIGLGGGSSIDSAKSIALMAKHDGDYW
DYIVGGTGKGKVPVNGALPIVAITTTAGTGTEADPWTVITNEETNEKIGYGNQYTFPTLS
VVDPELMLSVPPHLTAYQGFDAFFHAVEGYIAKIATPVSSMFALKSVELIAKYLPICVKD
GTNIEARTYVALANTLAGFVESTSSCTSEHSMEHALSAFYPDLPHGAGLIMLSEAYHTFF
ASKVPKKYIQLARAMGVDVEQLPEDERPFAFVKAMKKLQEECGVGNLKMSDYGIKEDEIE
KLADNAIKTMGGLFEVDPYKLSFEETVGIMRKAYK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttggttttcaattattttatacccacaaagatcttgtttggaccaagaagt
ttgaacagactcaaagacgaaaatttgcccggaaagaaagctctgattgtaatatctgct
ggaacatctatgaaaaagtatggttatctggacaggcttacagcgatattaaaagaaaag
ggaattgagtatgttgtatttgataagattttgcccaatcctatcaagaaacatgttatg
gaaggggcaaaattagcaaaagaagaaggctgcgactttgtaattggtcttggtggagga
agtagcattgactctgcaaaaagtattgctctgatggcaaaacacgatggtgattactgg
gactatatagtaggcgggacaggcaaaggcaaagtacctgtaaatggtgcacttccaatt
gttgcaataaccacaacagctggaactggaacagaggctgacccttggactgttataaca
aatgaagagacaaacgagaagataggttatggcaaccagtacacattcccaactttgtcg
gttgtagacccagagcttatgctaagtgtacctccgcaccttactgcttaccaagggttt
gatgctttcttccatgcagttgaagggtatattgcaaagattgcaactccagtcagtagc
atgtttgcactcaaaagcgttgagcttatagcaaagtacttgccgatttgtgtaaaagat
gggacaaatatagaggcaagaacatatgttgcacttgcgaacacgttggcagggtttgtt
gagtcgacttccagctgtacatcagagcattcaatggaacatgccctctctgcattttat
ccagatttgccacatggtgcaggacttataatgctatctgaagcttatcatacattcttt
gcatcaaaagtgcctaaaaaatacattcagcttgcaagagcaatgggtgttgatgtagaa
caacttccagaagatgaaagaccgtttgcatttgtcaaggcaatgaaaaagcttcaggaa
gagtgtggagttgggaatttaaagatgtctgactatggaattaaagaggatgagattgaa
aagcttgctgataatgctataaaaacaatgggcggactttttgaggttgatccatataag
ctttcttttgaagagacagtaggaattatgagaaaggcttataaataa

DBGET integrated database retrieval system