KEGG   Caldicellulosiruptor bescii: Athe_2244Help
Entry
Athe_2244         CDS       T00857                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Athe_2244
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Athe_2244
  Lipid metabolism
   00071 Fatty acid degradation
    Athe_2244
  Amino acid metabolism
   00350 Tyrosine metabolism
    Athe_2244
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Athe_2244
   00626 Naphthalene degradation
    Athe_2244
Enzymes [BR:ate01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Athe_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2381789..2382976)
Genome map
AA seq 395 aa AA seqDB search
MENLVFNYFIPTKILFGPRSLNRLKDENLPGKKALIVISAGTSMKKYGYLDRLTAILKEK
GIEYVVFDKILPNPIKKHVMEGAKLAKEEGCDFVIGLGGGSSIDSAKSIALMAKHDGDYW
DYIVGGTGKGKVPVNGALPIVAITTTAGTGTEADPWTVITNEETNEKIGYGNQYTFPTLS
VVDPELMLSVPPHLTAYQGFDAFFHAVEGYIAKIATPVSSMFALKSVELIAKYLPICVKD
GTNIEARTYVALANTLAGFVESTSSCTSEHSMEHALSAFYPDLPHGAGLIMLSEAYHTFF
ASKVPKKYIQLARAMGVDVEQLPEDERPFAFVKAMKKLQEECGVGNLKMSDYGIKEDEIE
KLADNAIKTMGGLFEVDPYKLSFEETVGIMRKAYK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttggttttcaattattttatacccacaaagatcttgtttggaccaagaagt
ttgaacagactcaaagacgaaaatttgcccggaaagaaagctctgattgtaatatctgct
ggaacatctatgaaaaagtatggttatctggacaggcttacagcgatattaaaagaaaag
ggaattgagtatgttgtatttgataagattttgcccaatcctatcaagaaacatgttatg
gaaggggcaaaattagcaaaagaagaaggctgcgactttgtaattggtcttggtggagga
agtagcattgactctgcaaaaagtattgctctgatggcaaaacacgatggtgattactgg
gactatatagtaggcgggacaggcaaaggcaaagtacctgtaaatggtgcacttccaatt
gttgcaataaccacaacagctggaactggaacagaggctgacccttggactgttataaca
aatgaagagacaaacgagaagataggttatggcaaccagtacacattcccaactttgtcg
gttgtagacccagagcttatgctaagtgtacctccgcaccttactgcttaccaagggttt
gatgctttcttccatgcagttgaagggtatattgcaaagattgcaactccagtcagtagc
atgtttgcactcaaaagcgttgagcttatagcaaagtacttgccgatttgtgtaaaagat
gggacaaatatagaggcaagaacatatgttgcacttgcgaacacgttggcagggtttgtt
gagtcgacttccagctgtacatcagagcattcaatggaacatgccctctctgcattttat
ccagatttgccacatggtgcaggacttataatgctatctgaagcttatcatacattcttt
gcatcaaaagtgcctaaaaaatacattcagcttgcaagagcaatgggtgttgatgtagaa
caacttccagaagatgaaagaccgtttgcatttgtcaaggcaatgaaaaagcttcaggaa
gagtgtggagttgggaatttaaagatgtctgactatggaattaaagaggatgagattgaa
aagcttgctgataatgctataaaaacaatgggcggactttttgaggttgatccatataag
ctttcttttgaagagacagtaggaattatgagaaaggcttataaataa

DBGET integrated database retrieval system