KEGG   Caldicellulosiruptor bescii: Athe_2368Help
Entry
Athe_2368         CDS       T00857                                 

Definition
hypothetical protein
Organism
ate  Caldicellulosiruptor bescii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2514452..2515909
Genome map
AA seq 485 aa AA seqDB search
MVKFDIKNILGSFKSRKFKFGGYAAMLTASVIAIVIVLNLLVGQIPAKFDLTHNRLYSLS
KPTVELLKNLKKDVTIYALFPSGNENPVISEFIQKYADKSSHVKIKYIDPYKNPGFVKKY
DTSGSGIDEGSLIVESGNKFRVINRYDMVDYSYDEQTGNTNVTGLTIEQKLTPAILYVTS
EKTPIIYELKGHGEDTFIGLGISSEVEAANFEIKDLNLLTEKSVPQDASAVVVISPKTDI
SDIELKKLKDYINGGGRVLFLMDLLKDELKNFNSIFESLGVRLEHGIVMEGDNTKNAGNP
VWILPNLESHDITNPIDLNNMYMLLPSAQPIVETKFKKRTITIEKLLTTTSNSWLRKDLN
STSLSKEKGDISGPFTLAVAITDKADSLNAKLRPRDTKVVIVGSAIFANSRFSKNVPGNL
NFVVNALNWLQDKKNTLQIQPKDLTTFRLNLSTSQAMIWAAITVVGIPVLILILGLTIWL
RRRHL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtttgatataaaaaatatccttggttcatttaaatcgaggaagttcaagttt
ggcggatatgcagcaatgctgacagcttcagttattgctattgtcattgtcctcaacctt
ttggtaggtcagatacctgcaaaatttgaccttacgcacaatagattatattcactttca
aaaccaactgttgaacttttgaaaaatctcaaaaaagatgtaacaatttatgctctgttc
ccatcaggtaatgaaaaccccgtgatttcagaattcatacaaaaatatgctgacaagtcc
tctcatgtaaaaataaaatacatagacccatacaaaaacccagggtttgtaaaaaagtac
gacacaagcggttcagggattgatgaagggtctttaatagttgaaagtggaaacaaattt
agagttataaatagatacgatatggtagattactcttatgacgaacaaacaggaaataca
aatgtaacaggcttgacaatagaacaaaaacttacccctgctatactttatgttacatct
gaaaaaacacctataatttatgagctgaaaggtcatggtgaagatacctttataggtctt
ggaatttcaagtgaggtagaagctgcaaactttgaaataaaagatttgaatttgcttaca
gaaaaaagtgtgccacaggatgcatcagctgttgttgtaatatcgccaaagacagatatt
tctgatattgaacttaaaaaactaaaagactatataaacggtggcggaagagtcttgttt
ttgatggacctgttaaaggatgagcttaaaaacttcaatagcatatttgaaagcttgggt
gttcgacttgaacatggtattgtaatggaaggtgataatacaaagaatgcaggaaatcct
gtttggattttgccaaatttagagtctcatgatatcacaaatccaatagacctaaacaat
atgtacatgcttttgccaagtgctcaacctattgttgaaacaaaattcaaaaagagaaca
ataacaattgaaaaacttctaacaacaacttctaattcatggctaagaaaagatttaaat
tctacatcactttcaaaagaaaaaggtgatatatcaggaccatttacacttgctgttgca
ataacagacaaagcagacagcttaaatgcaaagttaagaccgcgcgacacaaaagtagtt
atagtaggaagtgcaatttttgcgaattcacggttttccaaaaacgtcccaggaaacctc
aactttgttgtaaatgcattgaactggttgcaagataagaaaaacacactgcaaatccag
ccaaaagacttgacaacattcagacttaatcttagcacaagccaggctatgatctgggca
gcaataactgttgtggggatacctgttttgatacttattcttggcttgactatttggctt
aggaggagacatctatga

DBGET integrated database retrieval system