KEGG   Caldicellulosiruptor bescii: Athe_2726Help
Entry
Athe_2726         CDS       T00857                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ate03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2877903..2880128)
Genome map
AA seq 741 aa AA seqDB search
MQQNIQGMVSDIIYKNMENNYTVFEIICDDEVFTAVGIVPDIAIGEKVSVYGEFYVHPVY
GQQLKVSYLEKLLPQTKDEIYLYLSSGVIKGIGQKTAKKIVDTFGDDTARILQQEPEKLL
SIRGMTPEKVERIRNMFAFQKFLKDIMSIFSQYGLSQNHAMRLFKLYGFSALSLLQENPY
FLLDVFPELDFKKVDRLALDMGVMPDDKRRISAKILNLLTLAANNEGHTCLPENRLKQLC
IRTLDLPVEKIEEAIEALAQERRIVKDEVDSQEMVFLYGYYECERYIADKILSMLKEYDD
IADIDEKISQFEEKNGIAFSPNQKKAIKMALTQGVSIITGGPGTGKTTIIKCIIQIFEGE
GKKVFLCAPTGRAAKRMQAACERESKTIHRLLEITVLDTHVIFQKGPNNPLKCDVIVVDE
MSMVDSFLMNYLLAATKPTTRIVLVGDKDQLPSVGAGNVLKDFIKSQIVPCTTLTEVYRQ
SENSFIVLNAHRINRGEFPHLQKESDFYFIQKNSQEEILKTVIELVTKKLPNYLSCDPMT
DIQVLCPSKKGIVGMYNLNRVLQQYLNPPHPSKKEYAYKENLFRVGDKVMQVKNNYSLEY
EIVQGEEKGRASTGIFNGDIGVVKDIDRAQGALEILFDDEKLVYYDFSLLDDLELAYAMT
VHKSQGSEFRCIVMPVVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSALCDFLLRGQSNMQLQAL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacattcagggcatggtaagtgatataatctacaagaatatggaaaataat
tatacagtgtttgagataatatgtgacgatgaagtgtttacagcagtagggatagttcca
gacattgcaattggtgaaaaggtaagcgtgtacggtgagttttatgttcatccagtatat
ggtcagcagcttaaagtaagttaccttgagaagctattgccacagacaaaggatgagatt
tatctttatctttcctctggggtgataaagggtatcggtcaaaagactgctaaaaagatt
gttgatacctttggggatgacacagcaaggattttgcaacaagagcctgaaaagcttttg
agcattcgcggcatgacacctgaaaaggttgagcggataaggaatatgttcgcattccag
aaatttttgaaagatatcatgtcaatcttttcacagtacgggctttcacagaaccacgca
atgagactttttaagctttatggattttctgctctgtcacttttgcaggaaaatccatat
tttcttttggatgtatttccggagcttgactttaaaaaagttgacaggcttgcacttgac
atgggagttatgccagacgacaaaagaagaatatctgccaagatactcaatcttttgaca
ttggcagcaaacaacgaagggcacacatgcctgccagaaaataggctcaaacagctctgt
atcagaacccttgaccttccagtggaaaaaatagaagaggcaattgaagctttagctcaa
gaaagaagaattgtgaaagatgaggttgactctcaagagatggtgtttttgtacggctac
tatgagtgtgaaaggtatatagcagataaaatcctgtcaatgctaaaagaatatgatgac
attgctgatatagatgaaaaaatctcacagtttgaagaaaaaaacggtattgcattttcg
ccaaatcagaaaaaagctatcaagatggcgctgacacaaggtgttagcatcataacaggc
ggtcctggaacaggaaaaactacaatcataaaatgcatcattcagattttcgagggcgaa
ggcaaaaaggtttttctttgcgcgccgacgggaagggctgcaaagaggatgcaggcagca
tgtgaaagagaatcaaagacaatccatagactattagaaataacagtattagacacacat
gttatattccagaaaggaccaaataatcccttaaaatgcgatgttattgtggttgatgaa
atgagcatggtagacagtttccttatgaactatcttcttgctgcaacaaagccgacgaca
agaattgtccttgttggagacaaagaccagcttccatctgttggtgcaggaaatgtctta
aaagactttataaaaagccagattgtgccgtgtacaactttgaccgaggtgtatcgccag
agcgaaaatagttttatagttctcaacgctcacaggataaacaggggagagtttccacat
cttcaaaaggagagcgatttttattttatccagaaaaactctcaggaagagattttaaaa
actgtaattgagcttgtgaccaaaaaacttccaaactatctttcgtgcgacccgatgaca
gacattcaagttttgtgcccttccaaaaagggaattgttgggatgtacaatctaaaccgc
gtgttgcagcagtacctcaacccgcctcatccatctaaaaaggagtatgcctacaaggaa
aacctgttcagggttggggacaaggtcatgcaggtgaaaaacaactattcgctggaatat
gagattgtacaaggagaggagaagggcagggcctcaacagggatattcaacggcgacatt
ggagttgtaaaggatatcgacagggctcaaggtgctttggaaattttgtttgacgatgaa
aagcttgtgtattacgacttttcgctgcttgacgacttagaacttgcatatgccatgact
gttcacaaatctcaagggtctgagtttaggtgcatagtgatgccggttgttgagacctac
cccattttgatgacaagaaacctcctttacactgccgtaacacgggcaaaagaacttgtt
gtgctggtgggtaaaaaaagcgccttagagtatatgatagcaaaccagaaagaggctatg
cgatattcagcgctttgcgactttttattgcgcgggcaatcaaatatgcaattgcaagct
ttatga

DBGET integrated database retrieval system